SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008750 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008750
Domain Number 1 Region: 454-748
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 3.14e-42
Family Galactose oxidase, central domain 0.015
Further Details:      
 
Domain Number 2 Region: 899-1044
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-22
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 3 Region: 243-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-22
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1178-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008750
Domain Number - Region: 214-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000691
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 363-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008750   Gene: ENSMPUG00000008820   Transcript: ENSMPUT00000008893
Sequence length 1544
Comment pep:novel scaffold:MusPutFur1.0:GL897073.1:2808582:2956847:-1 gene:ENSMPUG00000008820 transcript:ENSMPUT00000008893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRQSTGRGRLRDANLSPPGRAKGKTGALMRLEPEAGGFSTTCTPGARDPPPRPRVQEE
GPRAAPRPRTHASPACCAALAPPSGLTARATVRTAPPRTARQSGAGRAVCVYVFAGRRLS
PGKMVAVAAATQARLRRRTAVTTAPAGRNGGQHRDWDATGAGRPGLGAGLRLPRRRLLLL
LLLLLLPPLLLLPWAAEAAAGGAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWV
GEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDH
LYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVTTSGYALLHFFSDAAYNLTGFNITY
NFDMCPNNCSGRGECKSSNSSNTVQCECSENWKGEACDIPHCVHDCGFPYRGVCNSSDVR
GCSCFPEWQGPGCSIPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSD
YNMVLAYDLASREWLTLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFH
IHNESWVLLTPKAKEQYAVVGHSAHIVKLKTGRVVMLVIFGHCPLYGYISNVQEYDLAKN
TWSILQTNGALVQGGYGHSSVYDHRTKALYVHGGYKAFSANKYRLADDLYRYDVDTQMWT
ILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPR
PDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCGAHRSEAACLAAGPGIR
CVWDTGSSQCISWELATEAQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCSD
HCVPVNQSCTEGQTSISRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPE
NICGISWHLVGNSCLKITTAKENYDNAKLSCRNHNAFLASLTTPKKVEFVLKQLRIMQSS
QSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNTLLQWMPSEPSDAGFCGILSEPSTRGLK
AATCINPLNGSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYV
ASFPFGQCMEWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPV
KMPSQAPAGNSYPQPLLNASMCLEDSRYNWSFIHCPACQCNGHSKCVNQSICEKCENLTT
GKHCETCISGFYGDPTNGGRCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENR
YQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNL
NITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIK
IQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMAS
RPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNRAAVLSVFVRLPRGLGGIPPP
GQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences M3YBP3
ENSMPUP00000008750 ENSMPUP00000008750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]