SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008828 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008828
Domain Number 1 Region: 114-224
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000126
Family Cadherin 0.005
Further Details:      
 
Domain Number 2 Region: 247-351
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008828
Domain Number - Region: 65-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.000361
Family Cadherin 0.027
Further Details:      
 
Domain Number - Region: 347-456
Classification Level Classification E-value
Superfamily Cadherin-like 0.000471
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008828   Gene: ENSMPUG00000008898   Transcript: ENSMPUT00000008972
Sequence length 841
Comment pep:novel scaffold:MusPutFur1.0:GL897275.1:382553:390462:-1 gene:ENSMPUG00000008898 transcript:ENSMPUT00000008972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAWALLLSLLMATARAQGTCGAGAVCSVSDTIFEVAENTNRPEPLADISVPAGQHVTLG
PSSTPDAFRIQGTQLFLNVTPDYEENTMLEAHLECRSGGTVVTQLRVFVFVLDINDNPPT
FPFQVKVEKVSEDTKVSTIVIPATGLEAQDRDQDDILFYTLQEVTPGAGSFFSLVGTNLP
ALRLDRRLDFDAQQSIDFLLLVRDTREENAEPSHTATATLILEVQPADLRPPWFLPCAYS
DHHVCINAEYHGAVPTGHQLPGPLVLRPGPVHAVDGDQGISQHILYSIVRGQEDGTFAIG
ADSGNLTMTKSVPSPKTFTLVVKGEQADGARYSVTWVQIEARNAAGSPPYFAKSRYHGMV
ARGSGGGVEVKDAAAPSLPLRVWAQDPDFPDLNSAITYRVTNNTDFRMDGETLLTASLLA
DEGVFYAEVEANNTVTASTARTVVEVQVLEWEEPTPPTGSPETPTSPETGRTSRPPSSTT
SEAPRPPGPSQGPSTASSGPSQGPQPPSSTIPRPPASSTPGGPPSVETSTFLPSASTSGG
STQSLKPGTSQPMPSGPSRTPQTSGVPALPSWSLLWCWAPHFHQELPPQGPREHTAPRQG
GGRQGSGTMPQNPSSGCLKPGAGLSGPAQTGGGSTAGTPGDGEPGVGAAGDRRFSVVDMA
ALGGVLGALLLLALLALLILVHKHYGQQLKCCSGKAVEQPLSFDNEAFDAPQEANWAPAP
YSSPGLMRAAPEPAEPPEPALPEPPSTTTLRPASESPELTRDGGSPAAVRSILTKERRPE
GGYKAVWFGEDIGAEADVVVLNTPASDAAGANDSGSEAGSDEEAVAGPHADDTPSTGSSY
V
Download sequence
Identical sequences M3YBX1
ENSMPUP00000008828 ENSMPUP00000008828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]