SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008881 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008881
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.15e-31
Family AN1-like Zinc finger 0.0000189
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008881   Gene: ENSMPUG00000008951   Transcript: ENSMPUT00000009025
Sequence length 213
Comment pep:novel scaffold:MusPutFur1.0:GL897043.1:2197546:2202773:1 gene:ENSMPUG00000008951 transcript:ENSMPUT00000009025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVS
EPVVTQPSPSVSQPSTSQGEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences G1LL51 M3YC24
ENSMPUP00000008881 ENSAMEP00000007673 ENSAMEP00000007673 ENSMPUP00000008881 XP_002914790.1.58354 XP_004397604.1.74151 XP_004397605.1.74151 XP_004769263.1.14098 XP_004769264.1.14098 XP_008689184.1.72690 XP_021549989.1.83697 XP_021549990.1.83697 XP_021549991.1.83697 XP_021549992.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]