SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008882 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008882
Domain Number 1 Region: 159-317
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.62e-51
Family Myf domain 0.0000000508
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008882
Domain Number - Region: 22-77
Classification Level Classification E-value
Superfamily t-snare proteins 0.0243
Family t-snare proteins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008882   Gene: ENSMPUG00000008952   Transcript: ENSMPUT00000009026
Sequence length 320
Comment pep:novel scaffold:MusPutFur1.0:GL896920.1:10176449:10208444:-1 gene:ENSMPUG00000008952 transcript:ENSMPUT00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFCCFLAKMATNSAVLKRLEQKGAEADQIIEYLKQQVALLKEKAILQATLREEKKLRVE
NAKLKKEIEELKQELIQAEIQNGVKQVPFPSGTLLQANSTVSENVIQSRPITTMTSATKE
QIGRGAEEKKMKEKIEVKGEKKEKKQQSVAGSIDSKPVDVSRLDLRVGCIITARKHPDAD
SLYVEEVDVGETAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVISQAMVMCASS
PEKVEILAPPNGSVPGDRIVFDAFPGEPDKELNPKKKIWEQIQPDLFTNDECVATYKGAP
FEVKGKGVCRAQTMTNSGIK
Download sequence
Identical sequences M3YC25
ENSMPUP00000008882 XP_004748176.1.14098 ENSMPUP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]