SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008960 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008960
Domain Number 1 Region: 215-425
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.6e-54
Family Reprolysin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000249
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 890-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 841-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008960   Gene: ENSMPUG00000009032   Transcript: ENSMPUT00000009107
Sequence length 950
Comment pep:novel scaffold:MusPutFur1.0:GL896998.1:2462826:2486087:1 gene:ENSMPUG00000009032 transcript:ENSMPUT00000009107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGILTLALAGVPAGGSEPDQEVVVPIRLDPDINGRHYYRRGPEDSGDQGLIFQITAF
QEDFYLHLTLDAQFLAPAFATEHLGFHLPALTGSSPDLRRCFYSGDVNAEPDSFAAMSLC
GGLRGAFGYRGAEYVISPLPNASAQAAQRNSQGAHLLQRRGAPGGPPGDPTSRCGVASGW
NPAILRALDPYKPREAGLGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLGDRDTGPKVTGNAAMTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDPPSKPISLPEDLPGTSYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGHMVC
QTRHFPWADGTSCGEGKFCLKGTCVERHNLNKYKVDGSWAKWEPYGTCSRTCGGGVQLAQ
RQCSNPTPANGGKYCEGVRVKYRSCNLEPCPSSASSKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCTPDSTSVCVQGKCIKAGCD
GNLGSKKKFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLV
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPWEDKASHPKDPRGSSVHHNSVLSLSNQVEQQDDRPL
ARWVAGSWGPCSVSCGSGLQKRAVDCRGPPGPRSTSACDAAHRPVEMRACGEPCPTWELG
AWSPCSKSCGRGFKRRPLKCLGPGGRLLARDQCNLRRKPQELDFCVLRPC
Download sequence
Identical sequences M3YCA3
ENSMPUP00000008960 ENSMPUP00000008960 XP_004763986.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]