SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008991 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008991
Domain Number 1 Region: 555-667
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-23
Family Cadherin 0.0027
Further Details:      
 
Domain Number 2 Region: 119-233
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-20
Family Cadherin 0.0003
Further Details:      
 
Domain Number 3 Region: 333-440
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-17
Family Cadherin 0.00091
Further Details:      
 
Domain Number 4 Region: 441-558
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 243-339
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 34-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000385
Family Cadherin 0.0037
Further Details:      
 
Domain Number 7 Region: 659-762
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008991   Gene: ENSMPUG00000009064   Transcript: ENSMPUT00000009139
Sequence length 831
Comment pep:novel scaffold:MusPutFur1.0:GL897034.1:3193362:3310256:1 gene:ENSMPUG00000009064 transcript:ENSMPUT00000009139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQAQLNCLCLLMLYLTTGYSQERKFSGPLEPMTFSIFEGQEASQVIFQFKAKPPAVNFK
LTGETDGIFQIQSDGLLYHNKALDRETRAVHRLQVSTLDAQGATVEGPVPITIEVKDIND
NRPMFLQQKYEGSVRQNSRPGKPFMYVNATDPDDPATPNGQLLYEIVIQLPMINNIMYFQ
INNKTGGISLTVDGSRELDPSKNPSYSLVVSVKDMGGQNENSFSDSTSVDIIVNENIWKA
PEPVEIVENSTDPHPIKITQVQWNEPGARYSLTGKEKGPKFPFSIDEEGGIYVTQPLDRE
EKDSYVFYATAMDEGGRLLSVPLEIRVKVKDINDNPPTCPSAVTVFEVQENEIIGSNIGT
FIAHDEDEENTVNSILGYRIVDQIPKFPKEGLFLVQTYSGVFQLAAQSLKKQDTPQYNLT
VEVADKDFKTLCDVQIHVIDINDQIPIFEKSDYGILTLAEDTAVGSTILTIQATDADEPF
TGSSKILYRIIQGDSDGQLGVDTDPQTNAGYVIIKKPLDFETAAIHDIVFQAENPEPLVY
GVNYNTSSSATFKLIVTDVNEAPVFSQRIYQAKVREDVAVGTKVGNVTARDPENLDISYS
LRDDRRGWLKIDPVTGQISTRAPVDREAESMYVVHVVATEIGGSHLSSIASFHLTLSDVN
DNPPRLAKDDAGLFLCHPLQTTGSVIFEATDDDQQSFLGPQFTFSLDSEFLQSNWEVSKI
NGTHARLATKHTNFEERVYNVPIRIKDGGRPPLERVVSLPVTFCKCVDGSCFLPAGHHSG
MPTVGMAVGILLTTFLVIGIILAVVFIRIKKNGGKDNVESAQASEAQPLKN
Download sequence
Identical sequences M3YCD4
ENSMPUP00000008991 ENSMPUP00000008991 XP_004768623.1.14098 XP_004768624.1.14098 XP_004768625.1.14098 XP_004768626.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]