SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009002 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009002
Domain Number 1 Region: 7-258
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.32e-46
Family Lysophospholipase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009002   Gene: ENSMPUG00000009075   Transcript: ENSMPUT00000009150
Sequence length 482
Comment pep:known scaffold:MusPutFur1.0:GL897275.1:522667:528687:1 gene:ENSMPUG00000009075 transcript:ENSMPUT00000009150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPKEATWNISFAGCGFLGVYHVGVASCLREHAPFLVANATHIYGASAGALTATALVTGA
CLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLVKTLPADSHERASGRLGISLTR
VSDGENVIISQFSSKDELIQANVCSTFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPGVLREMCKQ
GYRDGLRFLRRNGLLNRPNPLLALPPAHNPPLKDEDVEDTQVAPVDGHGQPSREDHILDH
LPSRLNEALLEACIEPKDLLTTFSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPDV
PEDIRWMKEQTGSLCQYLVMRAKRKLGSHLPSSLSEQVELRRARSLPSVPLSCATYSEAL
PSWMRNSLSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASHAPTPPQLPPTLP
PC
Download sequence
Identical sequences M3YCE5
XP_004781182.1.14098 ENSMPUP00000009002 ENSMPUP00000009002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]