SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009091 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009091
Domain Number 1 Region: 252-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.38e-145
Family Lysophospholipase 0.000000428
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-28
Family Synaptotagmin-like (S variant) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009091   Gene: ENSMPUG00000009168   Transcript: ENSMPUT00000009244
Sequence length 783
Comment pep:known scaffold:MusPutFur1.0:GL896926.1:8569717:8582511:1 gene:ENSMPUG00000009168 transcript:ENSMPUT00000009244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAKIPGTCLLTVRVLQARGLPSKDLVTPSDCYVSLWLPTASSHRLQTRTVKNSRNPIW
NQSFRFRIHSQLKNVLQLQVFDQDLLTSDDPMLSVLFDLGTLQAGDFRRESFSLNPQGEE
RLEVEFRLQRLTDCAEQLVSNGILVARELSCLHVRLEEAGDQKQSEGRVQLVVPGSCEGQ
QEASVGAGPVCFHCPACWEQELGILLQGAPREQLKVPLSALPSGQVVRLVFPTSQEPLMR
VELRKEGPKELAVRLGCGPCAEEQAFLSRRKQLVARALKQVLQLDDDLQEDEVPVVAVMA
TGGGIRAMLSLYGQLAGLRELGLLDCVSYITGASGSTWALTNLYEDPEWSQKDLAGPTES
LKTQVTKSKLGVLAPSQLQRYRQELAERARLGHPPCFTNLWALISEGLLHEEPRDCTLSD
QREALSRGQNPLPIYCALNTKEKGLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFF
MGRLTKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWAQDQASRDKEQVPLL
KIEEPPTGAGRIAEFFTDLLTRRPLAQATHNFLRGLHFHKDYFHDPYFSTWKATKLDGFP
NQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLVLSLDYNLEGAFQQLQLLGRLCGEQ
GIPFPPISPSPEEQCQPRECHLFLDPDCPDAPAVLHFPLVDDSFREYSAPGIPRTPTEKA
AGEVNLSPSDSPYHYSKLTYSLEDADKLLRLTHYNICNNREQLLEALRGAVLRRRQRQHH
QPQ
Download sequence
Identical sequences M3YCN4
ENSMPUP00000009091 XP_004751227.1.14098 ENSMPUP00000009091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]