SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009127 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009127
Domain Number 1 Region: 125-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-40
Family Laminin G-like module 0.0000000117
Further Details:      
 
Domain Number 2 Region: 330-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.37e-36
Family Laminin G-like module 0.0000000603
Further Details:      
 
Domain Number 3 Region: 20-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000728
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 53-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000166
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009127
Domain Number - Region: 100-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000613
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0043
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009127   Gene: ENSMPUG00000009204   Transcript: ENSMPUT00000009280
Sequence length 541
Comment pep:novel scaffold:MusPutFur1.0:GL896915.1:366434:385371:1 gene:ENSMPUG00000009204 transcript:ENSMPUT00000009280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFYCQCRAGWGGRLCDRDVNECSQQNGGCGQICSNKPGSFYCACYSGYALAPDGRTCH
DVDECAEGGACGEAHCKNLPGSYSCVCDEGYVFSSSDKACRDVDECAEGRCEQACVNSPG
GYTCHCDGRGGLKLSPDMNTCEDILPCVPFNVAKSVKSLYLGRMFSGTPVIRLRFKRLQP
TRLVAEFDFRTFDPEGVLFFAGGRQDSAWIVLGLRAGRLELQLRYHGVGRVTSSGPVINH
GMWQTISVEELDRNLVVKVNKDAVMKIAVAGDLFQLDRGLYHLNLTVGGIPFKERDLVQP
INPRLDGCVRSWNWLNGEDTTIQETVKASPKMQCFSAATRGSFYPGTGFAFYSLDFARTP
ADAGTDTTWQIEVKARIRPATDTGVLLALVGGDHVVALSVALVDYHSTKKLKKQLVILAV
ESVTLALMEIKVCDGQEHRVAVSVHKDEATLEVDGTKGRSEVSAARLQELLATLATHLQG
SVLTFVGGLPDVPVTAAPVTAFYRGCMTLEVNRKVLDLDEAAYKHSDITSHSCPPVEQAT
P
Download sequence
Identical sequences M3YCS0
ENSMPUP00000009127 ENSMPUP00000009127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]