SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009260 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009260
Domain Number 1 Region: 228-430
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-47
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 523-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000034
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 941-987
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000811
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 880-938
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 818-876
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000118
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009260   Gene: ENSMPUG00000009335   Transcript: ENSMPUT00000009414
Sequence length 1168
Comment pep:novel scaffold:MusPutFur1.0:GL897018.1:4038201:4289799:1 gene:ENSMPUG00000009335 transcript:ENSMPUT00000009414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQIDLPIQNQSEYELVTPVSTNFEGHYLSHILSAIHKRRSPRDVSSDSEQLFFNISAFG
RDFHLRLRPNTQLVAPGAVVEWHETDLVSENITDPTDDHQSGNASERIWKTELLQTNCAY
VGDIMDIPGTFVAISNCDGLAGMIKSDDDEYFIEPLERGKQMEEENGRIHVVYKRSAVEG
ASGNMSHDCRYRGSNLGGLDDVGTISSSIHQQLKDAARHRRHTGENDYNIEVLLGVDDSV
VRFHGKEHVQNYLLTLMNIVNEIYHDESLGVHINVVLVRMIMLGYAKSISLIERGNPSRS
LENVCRWACQQQKSDPNHPEHHDHAIFLTRQDFGPAGMQGYAPVTGMCHPVRSCTLNHED
GFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRCSGQELKR
YIHSYDCLLDDPFEHDWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTFDPCKQLWCS
HPDNPYFCKTKKGPPLDGTECATGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCSRTCG
IGVRFRTRQCNNPAPINGGQDCPGVNFEYQLCNTEECPKHFEDFRAQQCQQRNSHFEYQN
TKHHWLPYEHPDSKKRCHLYCQSRETGDVVYMKQLVHDGTHCSYKDPYSICVRGECVKVG
CDKEIGSTKVEDKCGVCGGDNSHCRTIKGTFTRTPKKFGYLKMFDIPPGARHVLIQEDEA
SPHILAIKNQATGHYILNGKGEEAKSRTFIDLGVEWVYNIEDDIETLHTDGPLHDPVIVL
IIPQDNDTHSSLTYKYIIHEDSAPTISSNNVIQEELDTFEWALKSWSQCSKPCGGGFQYT
KYGCRRKSDNKMVHRSFCEVNKKPKPIRRMCNIQECTHPLWVAEEWEHCTKTCGSSGYQL
RTVRCLQPLHDGTNRSVHSKYCPAERPDNRRPCNRVPCPSHWKTGPWNECSVTCGEGTEV
RQVLCRAGDHCAGEKPEAVRACQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYNKLCCE
SCSKRGTTLPPPYLPEAAETHGDAVFNPSDLPGSLLMPTSSVPHRSEPPAERKRSLSRLP
AAGGPRPHSKPDGSHLPQRRAPLAGGKTLRLVSPATRSDPLSSPAEAAAARLPVVSESLD
AASQARTSRKDDRIIDKTGPVRSAALER
Download sequence
Identical sequences M3YD53
XP_004766354.1.14098 XP_012918886.1.14098 ENSMPUP00000009260 ENSMPUP00000009260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]