SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009338 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009338
Domain Number 1 Region: 40-251
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000169
Further Details:      
 
Domain Number 2 Region: 538-756
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-58
Family Ankyrin repeat 0.0000257
Further Details:      
 
Domain Number 3 Region: 247-379
Classification Level Classification E-value
Superfamily E set domains 4.43e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 4 Region: 804-885
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000129
Family DEATH domain, DD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009338   Gene: ENSMPUG00000009413   Transcript: ENSMPUT00000009492
Sequence length 971
Comment pep:known scaffold:MusPutFur1.0:GL896920.1:13373605:13497183:-1 gene:ENSMPUG00000009413 transcript:ENSMPUT00000009492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDDTYLGAHDQMFPLDSLSHTIFNPELFQPDMPLPTDGPYLQILEQPKQRGFRFRYVC
EGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG
ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACTKGYNPGLLVHPDLAYLQAE
GGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYD
SKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDFS
PTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR
KRQKLMPNFSDSFGGGSGAGAGGGGMFGGGGGGGGAGSTGPGYGFPHYGFPTYGGITFHP
GTTKSNAGMKHGTTDTPSKKDSEAGGKSVDGGAVSPSGKVTEPIEQDKKSSTGDDAVTLT
YTVGVKEENSRFQDNFFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGD
SVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEAVVEDLLRA
GADLSLLDRLGNSVLHLAAKEGQDKILSILLKHKKAALLMDHPNGEGLNAIHIAVMSNSL
PCLLLLVAAGADVNAQERKSGRTALHLAVERDNISLAGCLLLEGEAHVDSTTYDGTTALH
IAAGRGSTRLAALLKAAGADPLVQNFEPLYDLDDSWEKDGEDEGVVPGTTPLDMATNWQV
FDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGLGIL
NNAFRLSPAPSKTLMDNYEVSGGTIRELVEALRQMGYTEAIEVIQAAFCTPATVVPGPGK
ATPQTLSLPLSPASTRSPVDEVRDDSICDSGVETSFRKLSFTESLTSSSSLLTLNKVPHE
YGQEGPIEGKI
Download sequence
Identical sequences M3YDD1
ENSMPUP00000009338 XP_004748219.2.14098 ENSMPUP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]