SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009676 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009676
Domain Number 1 Region: 930-1142
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 1608-1846
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000183
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1134-1231
Classification Level Classification E-value
Superfamily PH domain-like 0.000000059
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009676   Gene: ENSMPUG00000009751   Transcript: ENSMPUT00000009832
Sequence length 1932
Comment pep:novel scaffold:MusPutFur1.0:GL897030.1:3288775:3345533:-1 gene:ENSMPUG00000009751 transcript:ENSMPUT00000009832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLFGGPGSRRPSADSEASSTPSPDGAVWEPPAREPRQPPTPPPRTCFPLAGLRSARPL
PGPGTEGRRRRQQQQQERAQRPADGLHSWHSFSQPQAGARASCSSSIASSYPVSRGRAAS
SSEEEEEVPPPPGEQSPAYHGGHSSGSDEDQDGEGGHSWGGRPGPRPGSSLLDKDCRPDS
YGLNLGSMDSAGGARSPEAPQSPRACSEEGAREWGTGLPPCGPGPQEGLRPVSDTVGGTF
RVAKVNFPAYLASPAGSRGSSRYSSTETLKDEDPWANRGSGGWGMYRSPSFGAGEGLLRP
QPRSRTKGPVGTTRALRDGGLELDKSRQRKSLSNPDIASETLTLLSFLRSDLSELRVRKP
GGRPNDLGSGPLDGRDSPSAGGPGAQLGPTPAPAPASPGIRPTLKDLTATLRRAKSFTCS
EKPVARRPSRTSTLKPSSSELLLAGPSTEEDPLPLVVQDQYVQEARQVFEKIQRMGAQQD
DGSDVPSGSLDWVGDMTQGQRSQEELSGPESSLTDEGIGADPEPLVSAFCSLGTTGVWRP
LSSSSAQTNHYGPGAEDGLGGWALVSPDTPPTSGALRRRRKVPPSGPGGTDLSNGEAGEA
YRSLSDPIPQRHRAATSEEPSGFSVDSNLLGSLSPKTGLPAAPAVDEGLTSGHSDWSVGS
EESKGYEEVIQNIVQGPGALGRVVDDRVAGKGPKKKSLSDPSRRGELTGPGLEGPGGEPI
REVEPMLPPSSSEPILAERRAEPEEPSPARGRAQSERALPKTPPASSTAHRDFHLDPKLA
DVLSPRLIRRGSKKRPARSSHQELQREEGNENQTSSLSRARPSSKHIRHASVPATFTPIM
VPEPPTSAGPPVAVPEPVGFPARAHTALQAPSLEDVTKQYMLTLHTGEVPAPGPVDMPCL
TPAAVPSAEAKPPEAARAPDEPAPASKCCSKPQVDMRKHVTMTLLDTEQSYVESLRTLMQ
GYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGDLLVQ
SFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPV
QRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQE
IEAHIEGMEDLQAPLRRFLRQEMVIEVKAVGGKKDRSLFLFTDLIICTTLKRKSGSLRRS
SMSLYTAASVIDTASKYKLLWKLPLEDADIVKGASQATNRENIQKAISRLDEDLTTLGQM
SKLSESLGFPHQSLDEALRDLSAAMHRDLSEKQALCYALSFPPTKLELCSTRPEGTDSFI
FEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTQSSCP
EPMPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQRRGHRERPAS
LRNPPEMALETPGPELDVEAVDEEAATLAEPGPQPCLHISIAGSGLEMAPGPAEGDPRPE
LVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETTSSEEEQDPGFL
PLSGSFGPGGPCSTSPMDGRALRRSSRGSFTRGSLEDLLNVDPEAYQSSVWLGTEDGCVH
VYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKS
VTLGSQGSPITKMVSVGGRLWCGCQNRILVLSPDTLQLEHTFHVGQDSSRSVACMVDSSL
GVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCE
ELLWVGTSAGVVLTMPTSSSAVSCPRAPLSPTGLGQGHTGHVRFLAAVQLPDGFSLLCPT
PPPPPDTGPEKLPSLEHRDSPRHRGPASARPKMLVISGGDGYEDFRLSSGGGGSSETVGR
DDSTNHLLLWRV
Download sequence
Identical sequences M3YEB9
ENSMPUP00000009676 ENSMPUP00000009676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]