SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009690 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009690
Domain Number 1 Region: 24-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.67e-57
Family FCH domain 0.0039
Further Details:      
 
Domain Number 2 Region: 592-677
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 3 Region: 495-562
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000119
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009690   Gene: ENSMPUG00000009765   Transcript: ENSMPUT00000009847
Sequence length 764
Comment pep:novel scaffold:MusPutFur1.0:GL897030.1:3500062:3793350:1 gene:ENSMPUG00000009765 transcript:ENSMPUT00000009847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKVTQELKNTQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGIQKL
ASQYLKRDWPGIKADDRNDYRSMYPVWKSFLEGTMQVAQSRINICENYKNFISEPARTVR
SLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLF
QSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGN
VYDHLKDYLIAFSRTELETCQAVQNTFQFLLETSSKVVRDYNLQLFLQENAVFHKPQPFQ
FQPCDSDTSLKAAQLVDIELSPVSALRMTIAESRQLESETGTTEEHSLNKEARKWATRVA
REHKNIVHQQRVLDDLECHGVAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLK
QIGVSVDTWLKSAMNQVMEELENERWARLPAVTNNGTLHSLNADPEREEGEEFEDNMDVF
DDSSSSPSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQ
VGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVSGSLNGDASVCFVKALY
DYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFSGRIGVFPSVLVEELSASENGDTP
RMREIQISPSPKPPGSLPPLPLYDQPPSSPYPSPDKRSSQYFPRSPSANENSFLAESPGF
SQASRHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences M3YED3
ENSMPUP00000009690 ENSMPUP00000009690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]