SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009707 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009707
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-23
Family PB1 domain 0.00000486
Further Details:      
 
Domain Number 2 Region: 205-262
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000118
Family ZZ domain 0.0094
Further Details:      
 
Domain Number 3 Region: 910-947
Classification Level Classification E-value
Superfamily UBA-like 0.0000000021
Family UBA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009707   Gene: ENSMPUG00000009782   Transcript: ENSMPUT00000009864
Sequence length 958
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:3007156:3034284:-1 gene:ENSMPUG00000009782 transcript:ENSMPUT00000009864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLTTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGSRVDEAPAPALPEKRPVVRAGKKPLAYYSSLVRVL
GSDMKTPEEPAAQQFPLAPRDADQPQDKPPDWFTSYLETFREQVVKETVEKLEQKLHEKL
VLQNPSLGSCPSEVSMPISEETLFLPENQFNWHIACNSCQRSIVGVRYQCSLCPSYNICE
DCESGPYAHDSNHILLKLRRPVVGSTEAFSHPRFPAPRLPAALEQARLQKQVDKNFLKAE
KQRLRAEKKQRKAEVKELKKQLKLHRKIHLWSSIHGLQSPRSPLGRPESLLQSPTLMLPL
QPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSGDTKLKFMWGNLTL
ASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPF
PSTEGPENIEKGMIGSSKADELTCQQEETFLLAKEEIQLDEATKQTKGTGTSIPQKTKNV
ANERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDNPLIEK
PGLGQIQEESEGAGFKVLPDSTASVKRKTQNSASVEEAEVDLSGTQFVCETVIRSLTLDA
APDHNPPCRQKSVHMKFASPEEGPLGDEQEETVHSAKEAVVEEEDNEEEEEEDELKDEVQ
SQSSTSSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGVEAGERLTGGENQ
LQEQSISDILMTSQTLDTVPLTPEVVGPPPQLSRSPPCTQLDGSPGLDLPVTIPEVSSVP
DQIRGEPRGSSGLVNSRQKSSDHSRHHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTA
QPIVSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQVNNNDWYSHRY
Download sequence
Identical sequences M3YEF0
ENSMPUP00000009707 XP_004772675.1.14098 XP_004772676.1.14098 ENSMPUP00000009707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]