SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009753 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009753
Domain Number 1 Region: 89-291
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.8e-55
Family Reprolysin-like 0.00034
Further Details:      
 
Domain Number 2 Region: 381-438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.85e-17
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 922-973
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 789-844
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 728-786
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 851-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 675-726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000085
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009753   Gene: ENSMPUG00000009827   Transcript: ENSMPUT00000009910
Sequence length 1017
Comment pep:novel scaffold:MusPutFur1.0:GL896939.1:9855743:9993796:1 gene:ENSMPUG00000009827 transcript:ENSMPUT00000009910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEKVQRCHSYPGSNGHHPGHSPAHTPLTSWSQEREHHHPRLQKQHFCGRRKKYAPKPP
TEDTYLRFDEYGSTGRPRRSAGRSQKGLNVETLVVADKKMVEKHGKANVTTYILTVMNMV
SSLFKDGTIGSDINIVVVSLILLEQEPGGLLINHHADQSLNSFCQWQSALTGKNGKRHDH
AILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMI
HDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQYLKKFLSTPQAGCLVDEPKQTGQYK
YPDKLPGQIYDADTQCKWQFGAKAKLCGLGFVKDICKSLWCHRVGHRCETKFMPAAEGTV
CGLSMWCRQGQCVKFGEHGPRPVHGQWSAWSKWSECSRTCGGGVRYQERHCNDPKPQYGG
KFCPGSSRMYQLCNINPCNENSLDFRAQQCAEYNSKPFRGWFYQWKPYTKVEEADRCKLY
CKAENFEFFFAMSGKVKDGTPCSPNKQDVCIDGICEPVGCDHELGSKAVLDACGVCKGDN
STCKFYKGLYLNQHKANAYYPVVTIPAGARSIEVQELHLSSSHLAVRSLGQKYYLTGGWN
IDWPGEFPFAGTVFEYQRTFNHPERLYAPGPTNETLVFEVLMQGKNPGIAWKYALPKVMN
GTQPASKKQNHAWTTVQSPCSVSCGGGYISVKAVCLRDQNTQVSSSFCNARTKPATEPKI
CNAFSCPAYWKPGEWSVCSRSCAGGQQSRKVQCVQKKPFQKEEAVLHSLCPVSTPTQVQA
CNSRACPPEWSLGPWSQCSKSCGRGVRKREVLCKSSPTAENVSETLCSSSPKPESQEGCV
LGRCPKNTRLQWVVSSWSECSMTCGLGVRRREMKCSEKPFQGKLITFPERRCRSIKKPNL
NLEETCQRGTCPARPSFGVAAVWFPSPWQQCTVTCGGGVQTRSVHCVQQGRPAASCPLHQ
KPPVLQACNTNFCPAPDKREDPSCVDFFSWCPLVPQHGVCNHKFYGQQCCKSCTRKS
Download sequence
Identical sequences M3YEJ6
ENSMPUP00000009753 ENSMPUP00000009753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]