SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009797 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009797
Domain Number 1 Region: 250-602
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.51e-116
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000186
Further Details:      
 
Domain Number 2 Region: 99-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-37
Family Anticodon-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009797   Gene: ENSMPUG00000009871   Transcript: ENSMPUT00000009956
Sequence length 625
Comment pep:known scaffold:MusPutFur1.0:GL896939.1:11262465:11275947:1 gene:ENSMPUG00000009871 transcript:ENSMPUT00000009956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQAAVRLVRGSLRQTSWARWGQRELRLYQLAPFTALHKDKPLSDKRSELKRRLKAEKK
IAEKEAKQKELSEKQLSQATAAATNHTADNGVGAEEETLDPNQYFKIRSQAVQQLKISGE
DPYPHKFHVDISLTDFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGV
KLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHM
LPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMN
VIPGGAVAKPFITYHNELDMNLYMRVAPELYHKILVVGGIDRVYEIGRQFRNEGIDLTHN
PEFTTCEFYMAYADYNDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGEACEIDFTPPFR
RISMVEELEKALGMKLPDTRLFETEETRKILDDICVARAVECPPPRTTARLLDKLVGEFL
ETTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPVRQRQLF
EEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVTMFLTDSNNIKEVLLFPA
MKPEDKKESGATTDTSENTTAGTSV
Download sequence
Identical sequences M3YEP0
XP_004754028.1.14098 ENSMPUP00000009797 ENSMPUP00000009797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]