SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010156 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010156
Domain Number 1 Region: 54-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 212-256
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000301
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 3 Region: 118-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000366
Family Fibronectin type I module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010156   Gene: ENSMPUG00000010231   Transcript: ENSMPUT00000010318
Sequence length 358
Comment pep:novel scaffold:MusPutFur1.0:GL896937.1:6321106:6337232:1 gene:ENSMPUG00000010231 transcript:ENSMPUT00000010318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLSMLLAAALGQFRCQAQGGAPLAAAAPEARPGGELGEPEVQPRRQFCHWPCKCPR
AQPSCPRGVSLLRDGCGCCKICAKQPGDVCNEADLCDPHKGLYCDYSADRPRFETGVCAH
LIAVGCEFNRVHYRNGQVFQPSPLFSCLCVSGAIGCTPLFIPKLDDSRCSGAKGTKKSDQ
SNCGLGPFQKQLSASYKAMPAYKNLPLVWKRKCLVQATKWTPCSRTCGMGVSDRVTNENS
NCEMRKERRLCYIQPCDSNIAKSVKIPKGKTCQPTFQLLKAEKFVFSGCSSTQSYKPTFC
GVCLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSELKIL
Download sequence
Identical sequences M3YFP9
XP_004753596.1.14098 ENSMPUP00000010156 ENSMPUP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]