SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010169 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010169
Domain Number 1 Region: 422-634
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-71
Family Eukaryotic proteases 0.0000000897
Further Details:      
 
Domain Number 2 Region: 17-80
Classification Level Classification E-value
Superfamily GLA-domain 9.76e-26
Family GLA-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 105-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010169   Gene: ENSMPUG00000010244   Transcript: ENSMPUT00000010331
Sequence length 634
Comment pep:novel scaffold:MusPutFur1.0:GL896915.1:742099:752251:-1 gene:ENSMPUG00000010244 transcript:ENSMPUT00000010331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLSPERASSILGRVRRANSFLEEMKKGNLERECMEETCSFEEAREVFEDTAKTTEFWNK
YADGDQCESSPCQHEGRCKDGLDEYTCACLEGYEGRNCELSTRKLCSVDNGDCEQFCREE
QSSVVCSCAGGYVLADNGKSCVSTEPFPCGKTTTRRSKRTVIVHSGQGPSEAEAGMQEQY
DPGDLPATQSTLLLLPFNETDRSPGEDSSSVIRIVGPQANTASPTSKTPTMGSACPDSQL
RNGVHLPKLSGGRGAFRENSVSPVRRGRGAWARPDPGRAASRAEPRSRRAPTSTCEPRRQ
GRDSGRHSVGGEGVGVCVGSGYPVWGTPDSCSPARPGGLPPELWRGRGRSDPGARGPGAE
TAEAQQNRPHVPCRALRGRQQIGRPWQSAGLSGEGGRGGCGPGEDVEEAGVRPHLTAVSP
QALLVNEENEGFCGGTILSEYYVLTAAHCLQQAKKFTVRVGERNTDKEEGNEAAHEVEMV
IRHNRFVRETYDFDIAVIRLRTPITFRMNVAPACLPQKDWAESTLMTQKTGFVSGFGKTH
EKGRLSSTLKMMEVPYVDRNTCKLSSSFSITQNMFCAGYDSKLEDACQGDSGGPHVTRFG
NTYFVTGIVSWGEGCARKGKYGIYTKVTNFLKWI
Download sequence
Identical sequences M3YFR2
ENSMPUP00000010169 ENSMPUP00000010169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]