SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010170 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010170
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000719
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000392
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010170   Gene: ENSMPUG00000010245   Transcript: ENSMPUT00000010332
Sequence length 264
Comment pep:known scaffold:MusPutFur1.0:GL896985.1:4979263:5004992:1 gene:ENSMPUG00000010245 transcript:ENSMPUT00000010332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLWLALCALARLWPGTLAGCAEAGRCCPGRDAACFVRGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSGCADQCKPAARVRRRPVQQEPRNGGAPCPPLEERAG
CLDYSTPQGLDCGHSFVPAFITTSAFNKERTRQAASPRWSTDTEDTGYCMEFKTESLTPH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences M3YFR3
ENSMPUP00000010170 ENSMPUP00000010170 XP_004762419.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]