SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010290 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010290
Domain Number 1 Region: 13-91
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.25e-29
Family eIF5a N-terminal domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 84-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.68e-23
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010290   Gene: ENSMPUG00000010364   Transcript: ENSMPUT00000010454
Sequence length 154
Comment pep:novel scaffold:MusPutFur1.0:GL896973.1:6849193:6851024:-1 gene:ENSMPUG00000010364 transcript:ENSMPUT00000010454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Download sequence
Identical sequences A0A0P6CBC1 A0A1A6GWM9 A0A1D5Q0G5 A0A1S3EZ93 A0A1S3WB21 A0A1U7SVD9 A0A1U7TGD8 A0A212D776 A0A250YAF7 A0A286XK14 A0A287B356 A0A2I3SQ16 A0A2J8RWX8 A0A2K5CGF3 A0A2K5JAC8 A0A2K5NWK6 A0A2K5QRM7 A0A2K5WMF8 A0A2K5ZG08 A0A2K6C9P6 A0A2K6FNQ4 A0A2K6KZ74 A0A2K6QYN8 C8BKE6 F1Q264 G1MDS6 G1PMB7 G3RTD0 G3UH27 G3VY46 H0XAT6 I3N6Z6 L5M242 L9KKY5 M3WE44 M3YG33 P63241 P63242 Q3T1J1 Q5BJ43 Q6EWQ7 S7Q3G3
GO.37617 gi|147899976|ref|NP_001088861| gi|60552517|gb|AAH91629| ENSCPOP00000008877 NP_001003658.1.59421 NP_001003658.1.76553 NP_001028853.1.100692 NP_001028853.1.4139 NP_001137233.1.87134 NP_001137233.1.92137 NP_001137234.1.87134 NP_001137234.1.92137 NP_001159665.1.66739 NP_001160061.1.92730 NP_001160062.1.92730 NP_001160063.1.92730 NP_001160064.1.92730 NP_001160065.1.92730 NP_001160066.1.92730 NP_001160067.1.92730 NP_001160068.1.92730 NP_001961.1.87134 NP_001961.1.92137 NP_853613.1.92730 XP_001365196.1.35504 XP_001918173.2.31192 XP_003131979.1.46622 XP_003131980.1.46622 XP_003230681.2.98722 XP_003315395.1.37143 XP_003466228.2.53824 XP_003497238.1.69978 XP_003768823.1.9362 XP_003810146.1.60992 XP_003810148.1.60992 XP_003810149.1.60992 XP_003996212.1.62641 XP_004022880.1.66739 XP_004058512.1.27298 XP_004058513.1.27298 XP_004058514.1.27298 XP_004266977.1.21590 XP_004376104.1.4749 XP_004398585.1.74151 XP_004398586.1.74151 XP_004398587.1.74151 XP_004398588.1.74151 XP_004433211.1.5094 XP_004433212.1.5094 XP_004433213.1.5094 XP_004475285.1.11602 XP_004594869.1.84141 XP_004604939.1.94378 XP_004604940.1.94378 XP_004638450.1.9945 XP_004638451.1.9945 XP_004669302.1.11716 XP_004669303.1.11716 XP_004684730.1.23501 XP_004684731.1.23501 XP_004712942.1.18182 XP_004857448.1.39548 XP_004857449.1.39548 XP_004857450.1.39548 XP_005256566.1.92137 XP_005332834.1.77405 XP_005332835.1.77405 XP_005349791.1.66349 XP_005349792.1.66349 XP_005399578.1.28644 XP_005399579.1.28644 XP_005582785.1.63531 XP_005582786.1.63531 XP_005620027.1.84170 XP_005620028.1.84170 XP_005620029.1.84170 XP_005890011.1.15283 XP_005890012.1.15283 XP_005967952.1.78601 XP_005967953.1.78601 XP_006037364.1.24877 XP_006060220.1.26621 XP_006060221.1.26621 XP_006060222.1.26621 XP_006105545.1.53796 XP_006105546.1.53796 XP_006246699.1.100692 XP_006246700.1.100692 XP_006738976.1.47382 XP_006761691.1.95426 XP_006922366.1.64745 XP_006939810.1.62641 XP_006973472.1.50099 XP_007100741.1.24612 XP_007166516.1.59432 XP_007457821.1.90284 XP_007483269.1.35504 XP_007483270.1.35504 XP_007521935.1.11023 XP_007521943.1.11023 XP_007625179.1.28591 XP_008008309.1.81039 XP_008008310.1.81039 XP_008059099.1.4292 XP_008151760.1.99482 XP_008151761.1.99482 XP_008151762.1.99482 XP_008151763.1.99482 XP_008528617.1.77740 XP_008572101.1.73410 XP_008686172.1.72690 XP_008854060.1.79516 XP_008854061.1.79516 XP_010338072.1.74449 XP_010338073.1.74449 XP_010375624.1.97406 XP_010375625.1.97406 XP_010594868.1.64505 XP_010594869.1.64505 XP_010613128.1.5607 XP_010613129.1.5607 XP_010845638.1.44457 XP_010845639.1.44457 XP_010845640.1.44457 XP_010964192.1.22495 XP_010994850.1.51371 XP_011229624.1.58354 XP_011247360.1.92730 XP_011357111.1.92234 XP_011725464.1.29376 XP_011725470.1.29376 XP_011725475.1.29376 XP_011725480.1.29376 XP_011813890.1.43180 XP_011813891.1.43180 XP_011813892.1.43180 XP_011849990.1.47321 XP_011908648.1.92194 XP_011908655.1.92194 XP_011908664.1.92194 XP_011908673.1.92194 XP_011978054.1.54773 XP_011978055.1.54773 XP_011978056.1.54773 XP_011978057.1.54773 XP_011978058.1.54773 XP_012040495.1.66739 XP_012040496.1.66739 XP_012040497.1.66739 XP_012312882.1.9421 XP_012312883.1.9421 XP_012387559.1.21590 XP_012404216.1.9362 XP_012410957.1.4749 XP_012511152.1.63892 XP_012581933.1.23501 XP_012632215.1.48125 XP_012632223.1.48125 XP_012632232.1.48125 XP_012632241.1.48125 XP_012661466.1.62490 XP_012661467.1.62490 XP_012868762.1.60039 XP_012915813.1.14098 XP_012932283.1.39548 XP_013004212.1.53824 XP_013202796.1.66349 XP_013843405.1.46622 XP_014405355.1.60319 XP_014407100.1.101512 XP_014444566.1.99106 XP_014716993.1.49734 XP_014973951.1.72884 XP_014973952.1.72884 XP_014973953.1.72884 XP_014973954.1.72884 XP_014973955.1.72884 XP_014973956.1.72884 XP_015107126.1.17985 XP_015275818.1.55130 XP_015293057.1.63531 XP_015293058.1.63531 XP_015314098.1.76553 XP_015359887.1.40921 XP_015847783.1.50099 XP_015997612.1.101085 XP_015997613.1.101085 XP_016043593.1.11023 XP_016078017.1.3490 XP_016286327.1.35504 XP_016786920.1.37143 XP_016786921.1.37143 XP_017387148.1.71028 XP_017387149.1.71028 XP_017530713.1.32401 XP_017530714.1.32401 XP_017650536.1.79516 XP_017705913.1.44346 XP_017705914.1.44346 XP_017705915.1.44346 XP_017920058.1.57651 XP_017920059.1.57651 XP_018868917.1.27298 XP_019269178.1.44245 XP_019350377.1.47583 XP_019520479.1.44202 XP_019520480.1.44202 XP_019520481.1.44202 XP_019600743.1.88060 XP_019600744.1.88060 XP_019660652.1.58354 XP_019672646.1.62641 XP_019672647.1.62641 XP_019836829.1.53367 XP_019836830.1.53367 XP_020007155.1.5219 XP_020007163.1.5219 XP_020007170.1.5219 XP_020655532.1.8467 XP_020655533.1.8467 XP_020655534.1.8467 XP_020768571.1.74333 XP_020768572.1.74333 XP_020768573.1.74333 XP_020768574.1.74333 XP_020768575.1.74333 XP_020822210.1.61212 XP_020822211.1.61212 XP_020822212.1.61212 XP_020822213.1.61212 XP_020822214.1.61212 XP_020923476.1.46622 XP_021067261.1.100879 XP_021067262.1.100879 XP_021067263.1.100879 XP_021067264.1.100879 XP_021067266.1.100879 XP_021067267.1.100879 XP_021067268.1.100879 XP_021067269.1.100879 XP_021503819.1.76796 XP_021503820.1.76796 XP_021550286.1.83697 XP_021550287.1.83697 XP_021550288.1.83697 XP_021550289.1.83697 XP_849028.1.84170 ENSOGAP00000012753 ENSMLUP00000012037 ENSMLUP00000012037 ENSCAFP00000023771 ENSSTOP00000020142 ENSMUSP00000047008 ENSSHAP00000008101 ENSSHAP00000008101 ENSLAFP00000027135 ENSSSCP00000019005 ENSOGAP00000012753 ENSCPOP00000008877 ENSGGOP00000019055 ENSCAFP00000023771 gi|219555710|ref|NP_001137233.1| gi|219555712|ref|NP_001137234.1| gi|4503545|ref|NP_001961.1| ENSRNOP00000022343 ENSAMEP00000017504 ENSAMEP00000017504 ENSBTAP00000002616 ENSMPUP00000010290 ENSLAFP00000027135 ENSSTOP00000020142 ENSP00000336776 ENSP00000390677 ENSP00000396073 ENSP00000458269 ENSP00000459196 ENSP00000459611 ENSBTAP00000002616 ENSMPUP00000010290 ENSMUSP00000047008 10090.ENSMUSP00000068651 10116.ENSRNOP00000022343 10141.ENSCPOP00000008877 28377.ENSACAP00000000807 9823.ENSSSCP00000019005 ENSMUSP00000047008 ENSMUSP00000067077 ENSMUSP00000068651 ENSMUSP00000104247 ENSMUSP00000104248 ENSMUSP00000104249 ENSMUSP00000104250 ENSMUSP00000104251 ENSMUSP00000104252 ENSMUSP00000104253 ENSMUSP00000132717 ENSRNOP00000022343 ENSP00000336776 ENSP00000390677 ENSP00000396073 ENSP00000458269 ENSP00000459196 ENSP00000459611 ENSSSCP00000019005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]