SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010294 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010294
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-81
Family Eukaryotic proteases 0.0008
Further Details:      
 
Domain Number 2 Region: 431-543
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-28
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 3 Region: 315-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-20
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010294   Gene: ENSMPUG00000010368   Transcript: ENSMPUT00000010458
Sequence length 597
Comment pep:novel scaffold:MusPutFur1.0:GL897236.1:125852:145114:1 gene:ENSMPUG00000010368 transcript:ENSMPUT00000010458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLNKNKLFLLLGMLCLEQGKPAILPLPRAPTCGRSLVKAQPGNYLNIFSRIVGGSQVEK
GSYPWQVSLKRRQKHICGGTIISAQWVITAAHCVANRNSATTLNVTAGEYDLSHIDPGEQ
TLTIETIIIHPYFSIKKPMDYDIALLKMDGAFHFGQFVGPMCLPELKERFEAGFICTTAG
WGRSAEDGVLSKVLQEVKLPILTQDECMAALLTLKKPFSGHTFLCTGFPDGGGDACQGDS
GGSLMCRNKEGTWTLAGVTSWGLGCGRGWRNNMRKDEQGSPGIFTDLRKVLPWIHKHIRT
GKRRKSSGAPCSEQGRVLRESEGELHFPESPFLYYESQQRCVWTLLAPEKMHVLLGVSHL
DAESCHHSYLSISSTDDRLMGKFCGKSLASSVLVGSNSLRLNFISDATDQAAGFNLTYKA
LKPNYLPDSGCSSFTVLFEEGLIQSLHYPEDYSDMASCNWVFQAPKRYLIKLSFQSLEVE
ESGDCTSDYVTVHRDVEGQEEIARLCGFVAPDPVLSSSGVMLISFQSDENVTFRGFQATV
SFIPETDLNISISEDQSMFLETWNVLPKDRSASGETWMWRETPTQRERQMNRKVETG
Download sequence
Identical sequences M3YG37
XP_004780219.1.14098 ENSMPUP00000010294 ENSMPUP00000010294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]