SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010379 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010379
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-34
Family SCAN domain 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010379   Gene: ENSMPUG00000010455   Transcript: ENSMPUT00000010546
Sequence length 324
Comment pep:novel scaffold:MusPutFur1.0:GL897236.1:825167:851280:-1 gene:ENSMPUG00000010455 transcript:ENSMPUT00000010546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLNKLMAISKPQNLIQREQSEVLKAEVSWQQESIPVMETYNSEASRQKFRHFQYLAVS
GPHEALSQLWEFCLQWLRPDVHTKQQILELLVLEQFLTILPEDLRTWVNLQHPKNSKEVV
SLIEEVIEMLKDEELSCKDSVLQKGSIKEKMEYDSLTGDSQKPLKKSEVRLREEGEEVGK
LIFPSYLSETLFVLNSFYGRNSLYQGTEHLFSKPVEISKLESKERRWTVEHKIPSTSVLD
RERISENQDSIPKQRINGKKSSPGVNMTRLTKSRSPSLDAWMSDDWLYRNQEHWDINLPE
EAFVHKTVYTEVGNFEVSENKKSL
Download sequence
Identical sequences M3YGC2
ENSMPUP00000010379 ENSMPUP00000010379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]