SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010401 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010401
Domain Number 1 Region: 332-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000138
Family PHD domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010401   Gene: ENSMPUG00000010478   Transcript: ENSMPUT00000010569
Sequence length 403
Comment pep:known scaffold:MusPutFur1.0:GL896973.1:6908912:6912745:1 gene:ENSMPUG00000010478 transcript:ENSMPUT00000010569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPAS
GSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQSGPTQPGPPRSTFSRLQ
APDSATLLEKMKLKDSLFDLDGPKMASPLSPTSLTHASRPPAALTPVPLSQGDLSQPPRK
KDRKNRKLGPGGGAGFGVLRRPRPAPGDGEKRSRIKKSKKRKLKKADRGDRLPPPGPPRA
PPSDTDSEEEEEEEEEEEEEDMAAVVGGEAPAPVLPTPPEAPRPPAAVHPEGAPPTDSES
KEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCG
TWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRVGGPPKSGEP
Download sequence
Identical sequences G9KGC2
XP_004760409.1.14098 ENSMPUP00000010401 ENSMPUP00000010401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]