SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010482 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010482
Domain Number 1 Region: 738-863
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-35
Family Bromodomain 0.00000107
Further Details:      
 
Domain Number 2 Region: 535-690
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.96e-21
Family N-acetyl transferase, NAT 0.0000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010482   Gene: ENSMPUG00000010560   Transcript: ENSMPUT00000010651
Sequence length 869
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:3843157:3851222:1 gene:ENSMPUG00000010560 transcript:ENSMPUT00000010651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRSDACALSAGCPCGPRAGSAAPRSAAGEDMAEPSQASTPAPATQPRPLQSPAPAPTP
TPAPSPASAPTPAPTPAPAPAPAAAPAGSTGTGGPGVGSGGTGSGGDPARPGLSQQQRAS
QRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCR
SCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKC
ILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYW
KLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHIFGRSLLRSIFTV
TRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQ
LVPRPATVSAAVVPSAPLFSPTMGGGSNSSLSLDSGGAEPMPGEKRKLPENLTLEDAKRL
RVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSL
TPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMF
PTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFS
KDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRK
VYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHP
SAWPFMEPVKKAEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYN
PPDSEYCRCASALEKFFYFKLKEGGLIDK
Download sequence
Identical sequences M3YGM5
ENSMPUP00000010482 ENSMPUP00000010482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]