SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010655 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010655
Domain Number 1 Region: 355-439
Classification Level Classification E-value
Superfamily DEATH domain 0.000000942
Family DEATH domain, DD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010655   Gene: ENSMPUG00000010741   Transcript: ENSMPUT00000010832
Sequence length 459
Comment pep:novel scaffold:MusPutFur1.0:GL897003.1:1195147:1226757:1 gene:ENSMPUG00000010741 transcript:ENSMPUT00000010832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCVLQAKQWEQMAYVGGCKRVPWLPMLVVSLLCSAKAEYSNCGENEYYNQTTGLCHECP
QCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDME
NDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECAGASPGVSANFPSTSGSSTL
SPFQHAHKELSGQGHLATALIIAMSTIFIMAIAIVLIIMFYIMKTKPSAPACCTSHPVKS
VEAQVSKEEEKKEAQDSVVIFSEKDEFEKLTTAPVKTAKSENDASSENEQLLSRSLDSDE
EPASDKQGSPELCLLSLVHLAREKSAATKSAGIQSRRKKILDVYANVCGVVEGLSPTELP
FDCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIP
ELLTKLVQIERLDAVESLCADILEWAGLVPPASQPPTTS
Download sequence
Identical sequences M3YH48
ENSMPUP00000010655 XP_012917842.1.14098 ENSMPUP00000010655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]