SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010674 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010674
Domain Number - Region: 230-263
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.0366
Family XRCC4, C-terminal oligomerization domain 0.019
Further Details:      
 
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0597
Family variant PHD-like domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010674   Gene: ENSMPUG00000010762   Transcript: ENSMPUT00000010853
Sequence length 297
Comment pep:known scaffold:MusPutFur1.0:GL897051.1:5260193:5287379:-1 gene:ENSMPUG00000010762 transcript:ENSMPUT00000010853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAEEQFVNIDLNDDNICSVCKLGTDKETLSFCHVCFELNIEGVPKSNLLHTKSLRGHKD
CFEKYHLIANQDCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHL
LNFRHKPDKKLLPQFDSQVPKYSAKWIDGSTGGLANGSQRILEQRGNTDFELAVLQDSGA
TLCHNSVLWPHSHNQTQKKEEIISNPEVDVGTQHPRYSREELNSMTLGEVKQLKAKLRQE
IQEVFEELTHQVQEKDSLASELHVRHVAIEQLLKNYSKLPCLQVGRTGMKSHLPINN
Download sequence
Identical sequences M3YH67
XP_004770570.1.14098 ENSMPUP00000010674 ENSMPUP00000010674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]