SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010747 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010747
Domain Number - Region: 152-222
Classification Level Classification E-value
Superfamily Caspase-like 0.00067
Family Caspase catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010747   Gene: ENSMPUG00000010835   Transcript: ENSMPUT00000010926
Sequence length 395
Comment pep:known scaffold:MusPutFur1.0:GL896961.1:5881810:6006598:1 gene:ENSMPUG00000010835 transcript:ENSMPUT00000010926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVASCFLSRGLTALAGLLLFSFGSLAASQIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYR
HVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVD
YRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPA
IGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPRSLCVSTPGHRTDLFQRDPKNVLI
TDFFGSVRKVEITTETISLQPDLEIMENRYEKDWMNEELMEPLKYAEQLPVAQIIHQKPK
LKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
Download sequence
Identical sequences M3YHE0
ENSMPUP00000010747 XP_004758224.1.14098 ENSMPUP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]