SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010776 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010776
Domain Number 1 Region: 217-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-51
Family Reprolysin-like 0.0041
Further Details:      
 
Domain Number 2 Region: 530-580
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 960-1016
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 844-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 912-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000615
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 790-849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010776   Gene: ENSMPUG00000010864   Transcript: ENSMPUT00000010955
Sequence length 1086
Comment pep:novel scaffold:MusPutFur1.0:GL896971.1:5114790:5442073:-1 gene:ENSMPUG00000010864 transcript:ENSMPUT00000010955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGALLPPLVLPLLLLLVWGLDPGTGSAPSPTTPSSPVPLAATTFLLPSRGVLAAPAAS
RVRPGERALLLHLPAFGRDLYLQLRHDLRFLSRGFEVEEAGTAGRRGRPAELCFYSGRVL
GHPGSLVSLSACGAGGGLVGLIQLGQEQVLIQPLNNSQGPLSVREHLVKRKWSSAPSPST
EAQGPGQLCQVLTEKKKPRRDRASQDWRERRNAIQLTSEHTVETLVVADADMVQYHGAEA
AQRFILTVMNMVYNMFQHQSLGSKVNIQVTKLVLLRQRPAKLSIGHHGERSLESFCHWQN
EEYGGARYLGNNQVPGGKDDTPPVDAAVFVTRTDFCVHKDEPCDTVGIAYLGGVCSAKRK
CVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKGRNPSDLSWSSCS
RDDLENFLKSKVSTCLLVTDPRSRHAIRLPHKLPGMHYSANEQCQILFGTNATFCRNMEH
LMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWSPWGAW
SMCSRTCGTGARFRQRKCDNPPPGPGGTHCLGASVEHAVCENLPCPKGLPSFRDQQCQTH
DRLSSKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGPYETDLCVHGKCQ
KIGCDGIIGSAAKEDRCGVCSGDGKTCRVVKGDFSHSRGTALKDTNKRSINSDWKIELPG
EYQIAGTTVRYVRRGLWEKISAKGPTKMPLHLMVLLFHDQNYGIHYEYTIPVNYTAENQS
EPEKPQDSLFLWTHSGWEGCSVQCGGGERRTIVSCTRIINKTTTLVNDSDCPQASRPEPQ
VRRCNSHPCQSRWVAGPWSPCSATCEKGIQHREVTCVYQLQDGTHVTTRPLYCPGPRPAP
VQSCEGQDCLSIWEASEWSQCSATCGKGTQKRTVTCTNSQGKCDASTRPKAEEVCEDYSG
CYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGNECPALLKPAAYRQCHQEVCNDKI
NVNTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYANKMRQPP
PPSLSS
Download sequence
Identical sequences M3YHG9
ENSMPUP00000010776 ENSMPUP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]