SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010830 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010830
Domain Number 1 Region: 352-430
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.42e-26
Family Intermediate filament protein, coiled coil region 0.00069
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000523
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 236-350
Classification Level Classification E-value
Superfamily Prefoldin 0.000022
Family Prefoldin 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010830
Domain Number - Region: 180-265
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010830   Gene: ENSMPUG00000010916   Transcript: ENSMPUT00000011009
Sequence length 572
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4246662:4266037:1 gene:ENSMPUG00000010916 transcript:ENSMPUT00000011009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTMTTCSRQFTSSSSMKGSCGIGGGSSRMSSVLAGGSCRAPSAYGGLSVSSSRYSSGGA
CGLGGGYGGGFSSSSSFGGGLGSGFGGGYGGGLGAGFGGGFGGGLGAGFGGGFGGGDGLL
VGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAETKDYSPYFKTIED
LRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADTNGLRRVLDELTLS
RADLEMQIESLKEELAYLKKNHEEEMNSLRGQVGGDVNVEMDAAPGVDLSRILNEMRDQY
EKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTVQNLEIELQSQLSM
KASLENSLEETKGRYCMQLAQIQDLIGNVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQE
IATYRRLLEGEDAHYGGGSSSGGGSGGNYGGGSSSGGGSGGKGGSGGSYGGGGSGGSYGG
GSSSGGGSGGSYGGGSSSGGGSGGRRGSGGSYGGGISSGGGSRGSYGGGSSSGGGSGGRG
GSGGSYGGGSSTGGGSGSSYGGGSSSGGGSGS
Download sequence
Identical sequences M3YHM3
ENSMPUP00000010830 ENSMPUP00000010830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]