SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010841 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010841
Domain Number 1 Region: 312-390
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-25
Family Intermediate filament protein, coiled coil region 0.00085
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000023
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Domain Number 3 Region: 194-308
Classification Level Classification E-value
Superfamily Prefoldin 0.0000418
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010841   Gene: ENSMPUG00000010928   Transcript: ENSMPUT00000011021
Sequence length 404
Comment pep:known scaffold:MusPutFur1.0:GL897072.1:4296031:4300136:1 gene:ENSMPUG00000010928 transcript:ENSMPUT00000011021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYSYRQSSATSSFGGLGGGSLRLGAGSAFRAPSIHGGSGGRGVSVSSARFVSSSSGGY
GGGYGGTFGSSFGARSDGLLAGNEKLTMQNLNDRLASYLDKVRALEEANGDLEVKIRDWY
QKQGPGPAHDYSHYFKTIEELREKILGATIENSKIVLQIDNARLAADDFRTKFETEQAMR
MSVEADINGLRRVLDELTLAKSDLEIQIESLKEELAYLKKNHEEEISVLRGQVGGQVSVE
VDSAPGIDLAKILGDMRSQYEVMAEKNRKDAEAWFISRTEELNREVAGNTEQLQISKSEV
TDLRRTLQGLEIELQSQLSMKAALESTLAETEARFGVQLAQIQTLISTLEAQLSEVRADT
ERQNQEYQQLMDVKSRLEQEIATYRSLLEGQDAQYNNLPTPKAL
Download sequence
Identical sequences M3YHN4
ENSMPUP00000010841 XP_004772805.1.14098 ENSMPUP00000010841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]