SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010860 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010860
Domain Number 1 Region: 205-308
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-28
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 88-183
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 308-416
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 5-95
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-18
Family Cadherin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010860   Gene: ENSMPUG00000010948   Transcript: ENSMPUT00000011041
Sequence length 617
Comment pep:novel scaffold:MusPutFur1.0:GL896975.1:9385:251642:1 gene:ENSMPUG00000010948 transcript:ENSMPUT00000011041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYS
VVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKAN
DADTGSNADMTYSIINGDGIGIFSISTDKETREGILSLKKPLNYEKKKSYTLTIEGANTH
LDFRFSHLGPFKDATMLKIIVGDVDEPPLFSMPSYVMEVYENAKIGTVVGTVLAQDPDSA
NSLVRYFIDYSAEDDRCFNIDANTGTIRTTKVLDREETPWYNITVAASENDNPGLQSHVT
VGIRVLDVNDNPPELAREYDIVVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLSI
NPNFTLKDNEDNTASILTRRRRFSRTIQDVYYLPIMISDGGIPSLSSSSTLTVRVCACER
DGRVRTCHAEAFLSSAGLSTGALIAILLCVVILLAIVVLFITLRRSKKEPLIISEEDVRE
NVVTYDDEGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVKLTPRHQTLSTLESIDVQ
EFIKQKLAEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDWGPE
FKKLAELYGEIESERTT
Download sequence
Identical sequences M3YHQ3
ENSMPUP00000010860 ENSMPUP00000010860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]