SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010877 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010877
Domain Number 1 Region: 333-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 102-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000152
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 215-329
Classification Level Classification E-value
Superfamily Prefoldin 0.0000785
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010877   Gene: ENSMPUG00000010966   Transcript: ENSMPUT00000011059
Sequence length 454
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4320222:4326481:1 gene:ENSMPUG00000010966 transcript:ENSMPUT00000011059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRLQSSSASYGGGFGGGSCQLGGGRSVSACSTRFVSGGSAGGYGGGMSCGFGGGAGSG
FGGGFGGGLGGGFGGGLGGGFGGGFGGGFGDYGGGDGGLLSGNEKITMQNLNDRLASYLE
KVRALEEANTELEVKIRDWYQKQSPSSPERDYSPYFKTIEELRDKILAATIDNNRVILEI
DNARLAADDFRLKYENELALRQSVEADINGLRRVLDELTLAKTDLEMQIEGLNEELAYLK
KNHEEEMKEFSSQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAEKNRRDAEEWFHSKS
AELTKEVTSSTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLEGTVADTECRYATQL
QQIQGLIGSLEAQLSELRSEMECQNQEYKTLLDIKSRLEQEIATYRSLLEGQDARMAGLT
SSGGKETTPGNSSVTVTTTSSNSSGRRTSGTGRL
Download sequence
Identical sequences M3YHS0
ENSMPUP00000010877 ENSMPUP00000010877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]