SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010903 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010903
Domain Number 1 Region: 419-567
Classification Level Classification E-value
Superfamily TRAF domain-like 1.37e-51
Family MATH domain 0.0000000562
Further Details:      
 
Domain Number 2 Region: 379-417
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000445
Family Trimerization domain of TRAF 0.00041
Further Details:      
 
Domain Number 3 Region: 79-125
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000542
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010903
Domain Number - Region: 156-212
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00131
Family SIAH, seven in absentia homolog 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010903   Gene: ENSMPUG00000010992   Transcript: ENSMPUT00000011085
Sequence length 569
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:127178:151083:-1 gene:ENSMPUG00000010992 transcript:ENSMPUT00000011085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSGRSGAAWPRVTHAGAATGPRSAPFLRPPRFMGLRSRWAERARWCAALMAAAGATPP
GSLDLLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSSCLTSILSSGPQNC
AACVHEGIYEEGVSILESGSAFPDNAARREVESLPAVCPSDGCTWTGTLKEYESCHEGHC
PFMLTECPACKGLVRLGEKERHSEHECPERSLSCRHCRAPCCWADMKAHHEVCPKFPLTC
DGCGKKKIPREKFQDHVRACGKCRLPCRFHVVGCPELVESEKQPQHEAHWLREHLAMLLG
GLLEAKPLSGAGDPFLSQSEMGGWEASTLLPKAAELQQRCEALERKTATFENIVCVLNRE
VERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMAELEQKVHEMEATTFDG
VFVWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFV
VMKGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLF
CPVSKMEAKNSYVRDDAIFIKAIVDLTGL
Download sequence
Identical sequences M3YHU6
ENSMPUP00000010903 XP_004756968.1.14098 ENSMPUP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]