SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010905 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010905
Domain Number 1 Region: 321-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.66e-24
Family Intermediate filament protein, coiled coil region 0.00093
Further Details:      
 
Domain Number 2 Region: 91-125
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000889
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Domain Number 3 Region: 204-319
Classification Level Classification E-value
Superfamily Prefoldin 0.0000254
Family Prefoldin 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010905
Domain Number - Region: 146-234
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010905   Gene: ENSMPUG00000010994   Transcript: ENSMPUT00000011087
Sequence length 467
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4338494:4342459:1 gene:ENSMPUG00000010994 transcript:ENSMPUT00000011087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQVCSPGFSSGSAKGLCSSAGGLSRVSSVRSVGSCRVPSLAGAVGSASSIRMGLSSLG
SCFPGSYLSAGCHPSGFVGSGGWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLERENTE
LEKRIREWYESQIPYICPDYQSYFKTIEELQQKILLTKAENARLVLQIDNAKLAADDFRT
KYETELSMRQLVESDMNGLRRILDELTLCKADLEAQVESLKEELLCLKKNHEEEVNVLRC
QLGDRLNVEVDAAPPVDLNKILDDMRCQYEALVENNRRDVEAWFNTQTEELNKQVVSSSE
QLQCCQTEIIELRRSVNALEIELQAQHSLRNSLESTLTETEARYGSQLAQMQCLISNVEA
QLAEIRCDLERQNQEYQVLLDVKARLESEIATYRRLLEGEDCKLPAHPCATECKPSMRGP
YVSTGPCAPAVPCGPAPQVSTQIRTITEEIRDGKVISSREHLQPCPL
Download sequence
Identical sequences M3YHU8
XP_004772806.1.14098 ENSMPUP00000010905 ENSMPUP00000010905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]