SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010914 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010914
Domain Number 1 Region: 325-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.02e-23
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 95-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000382
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 208-323
Classification Level Classification E-value
Superfamily Prefoldin 0.0000314
Family Prefoldin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010914   Gene: ENSMPUG00000011003   Transcript: ENSMPUT00000011096
Sequence length 455
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4347513:4351587:1 gene:ENSMPUG00000011003 transcript:ENSMPUT00000011096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKCLKASFSSGSLRGLGGAGGGSARVSAMYSSSSCKLPSLSRGARSFSACSVGLGRSS
SRAAGCLSALCLPAGGFTTSYNLGGGWFGDGVLTGSEKETMQSLNDRLASYLEKVRQLER
ENASLEGRIREWCEQQVPYLSPDYQSYFRTIEELQKKTLCTKAENARLVVQIDNAKLAAD
DFRTKYETELSMRQLVESDMNGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLDEMRCQYETLVENNRRDAEEWFNTQTEELNQQVV
SSSEQLQSCQAEIIELRRSVNALEIELQAQQSMRDALESTLAETEARYSSQLAQMQCLIS
NVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRGLLESEEGKLPCNPCAPDHTPA
KSCLPCLPAVSCGPGAVRSTCSPRTICVPCPGGRF
Download sequence
Identical sequences M3YHV7
ENSMPUP00000010914 XP_004772807.1.14098 ENSMPUP00000010914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]