SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010946 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010946
Domain Number 1 Region: 434-824
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.42e-133
Family Ankyrin repeat 0.000000000184
Further Details:      
 
Domain Number 2 Region: 98-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.98e-105
Family Ankyrin repeat 0.000000215
Further Details:      
 
Domain Number 3 Region: 3628-3740
Classification Level Classification E-value
Superfamily DEATH domain 7.07e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010946   Gene: ENSMPUG00000011035   Transcript: ENSMPUT00000011128
Sequence length 4028
Comment pep:novel scaffold:MusPutFur1.0:GL897012.1:1063188:1398498:-1 gene:ENSMPUG00000011035 transcript:ENSMPUT00000011128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKNGLTPLHLAAQEDRVNVAEVLVNQG
ANVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETMTTTTIIEKHKMNVPETM
NEVLDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASPKISSDRS
YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHS
GYSSPLPQYDSRFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLA
NPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEH
QFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEG
GILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRK
FHKPITMTIPVPPPSGEGVANGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKD
CVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESCLRCF
CMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFK
ENRLPFSIKVRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDQDDEA
EKADRRQSFASLALRKRYSYLTEPGMKTVERSAGATRSLPTTYSYKPFFSTRPYQSWTTA
PVTVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVKSISDVAS
PIRSFRTMSSPIKTVVSQSPYNIQVSSGNLVRAPTVPEASPLKGLASSSTFSSRTSPVTT
AGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSPAKSAVDVI
SSAKVTMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSMLINGCKATATLQEKISTAT
NSVSSVVNATTDTVEKVFSTTTAMPFSPLRSYVSSTPSAFQSLRTPSASALYTSLGSSIS
ATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSSSLTKSAAALLSPIKTLTTETRPQPHF
NRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKPF
QPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGPPKSPKSDKGLSPEDDW
IEFSSEEIREARQQAAASHSPSLPERVQVKAKAASEKDYNLTKVIDYLTNDIGSSSLTNL
KYKFEDAKKDGEERQKRILKPAIALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDTIL
ESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEV
VHVIRSYEPSAGDAPPGPPEEPVSPKPSPTFTELEPKPTTSSIKEKVKAFQMKANGDDDD
HSRVLSKGMRVKEETHITTTTRMVYHSPPGSEGASERIEETMSVHDIMKAFQSGRDPSKE
LAGLFEHKSAVPPDVHKSAAETPAQHAEKDNQMKPKLERIIEVHIEKGNQAEPTEVIIRE
TKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCPEEQGQQEEEELTAEESLPSYLES
SRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESYRFAEKMLL
SEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSREKVVTAPKKEILSKIYKDVSENGVGK
VSKDEHFDKVTVLHCSGDVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRTVKEAEEKLT
EVSQFFRDKTEKLNDELQSPEKKPRPRNGKEYSSQSSPGSSPEKVLLTELVASSDEWVKA
RQHGPDGPGVPTADEQKAASPPSSPEKKVLSPQPDDSKPTEETQESVSQSKAPAGPQSGF
QLKQSKLSSIRLKFEQGAQAKSKDVSQEERKPEGQSRIPVKKIQESKLPVYQVFAREKQL
KAVDLSDERGSAQNDLMVLKAKDEHAQSGELVVNDAGSEDVKTQRTEMSSKAMPDYFSEQ
QAKDLACHVTSDVATKGPWDKKVFRTWESSGATNNKSQKEKLSHVLVHNVRENHVGHPDS
KIVGQRHEFMSVTEREHKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGGRPGGPLEQA
PRRSESSAVSHIPVRAAEGRRMLSSDIPDGFCEQSTFPQQELSQKLPRSSMSKETVETQH
FNSIEDEKITYSEISKVSKRQSYVGLCPPLDETETSPTKSPDSLEFSPGKESPSSDVFDH
SPLDGLERVSPLAQTEGGKDIKTLPVYVSFVQVGKQYEKEIQQGSIKKIISQECKTVQET
RGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDS
LIAYIPGKPSPIPEVSEESEEEEQAKSASLKQTTVEEVTVDRETPTDVSKDSNQRPKSNR
VAYIEFPPPPPLDADQMEPDKKPHYLPEREADMIEVSLRDEHDKYQLAEPVIRVQPPSPV
PPGADVSDSSDDESLYQPVPVKKYTFKLKEVDDEQKEMTKSKAPADKPSSQKELETNGSG
KDHEFGLGLDSPQNETAQNGNNDQSVTECSIATTAEFSHDTDATEIDSLDGYDLQDEDDG
LTESDSKLPSQTMEIKKDVWNTEGILKPADRSFSQSKLEVIEEEGRVGPDEDKPPSKSSS
SEKTPDKTEQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWS
NNRGDDEVFDGKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEG
KMFEMTRSGAIDMSKRDFVEERLQFFQIGPQSPCERTDIRMAIVADHLGLSWTELARELN
FSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGP
IFDYGNISGTRSFADENNVFHDPVDGYSSLQVELETPTGLHYTPPTPFQQDDYFSDISSI
ESPLRTPSRLSDGLVPSQGNIEHSADGPPVVTAEDTSLEDSKLEDSMPLTEMPDAVDVDE
SHLENVCLSWQNETSSGNLESPAQARRITGGLLERLDDSPDQCRDSITSYLKGEPGKFEA
NGSHAEVTPEAKTKSYFPESQNDIGKQSVKETLKPKIHGSARVEEPASSLTAYQKALEET
SKFVIEEPKPCVPVSMKKMSRTPPADGKPRLNVHEEEGSSGSEQKQGEGYKVKTTKKEIR
NVEKKSHS
Download sequence
Identical sequences M3YHY9
ENSMPUP00000010946 ENSMPUP00000010946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]