SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011025 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011025
Domain Number 1 Region: 284-355
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.88e-23
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 44-78
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000068
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011025
Domain Number - Region: 156-272
Classification Level Classification E-value
Superfamily Prefoldin 0.00102
Family Prefoldin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011025   Gene: ENSMPUG00000011115   Transcript: ENSMPUT00000011209
Sequence length 399
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4417665:4420998:1 gene:ENSMPUG00000011115 transcript:ENSMPUT00000011209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSSTMPYNCCLPNVSCRSTCSSRPCVPPSCHTCGWFCEGSFNGSEKETMQFLNDRLASY
LEKVRQLERENAELESRIRERCQQQEPYVCPSYQSYFRTIEELQQKILCAKSENARLVVQ
IDNAKLAADDFRTKYETELGLRQLVESDINGLRRILDELTLCKSDLEAQVESLKEELLCL
KRNHEEEVNTLRCQIGDRLNVEVDAAPAVDLNRVLNETRCQYEALVETNRRDVEEWFTTQ
TEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTETEARYSSQ
LSQLQCMITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRGLLESEDCKLPCN
PCATTNACGSSGSCVSNSCAPCTPCVPRPRCGPCNSFVR
Download sequence
Identical sequences M3YI68
ENSMPUP00000011025 ENSMPUP00000011025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]