SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011052 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011052
Domain Number 1 Region: 2763-3024
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-69
Family Protein kinases, catalytic subunit 0.0000027
Further Details:      
 
Domain Number 2 Region: 1921-2117
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-54
Family DBL homology domain (DH-domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 1256-1434
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-50
Family DBL homology domain (DH-domain) 0.00000000844
Further Details:      
 
Domain Number 4 Region: 2119-2241
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-33
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 5 Region: 1438-1556
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2656-2752
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-23
Family I set domains 0.0083
Further Details:      
 
Domain Number 7 Region: 273-409
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1070-1207
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 820-973
Classification Level Classification E-value
Superfamily Spectrin repeat 6.01e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 494-635
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2521-2585
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000585
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 12 Region: 1607-1698
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000476
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 29-183
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 640-747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000984
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 15 Region: 187-303
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000236
Family Spectrin repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011052
Domain Number - Region: 414-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011052   Gene: ENSMPUG00000011143   Transcript: ENSMPUT00000011237
Sequence length 3072
Comment pep:known scaffold:MusPutFur1.0:GL896975.1:3976415:4202766:-1 gene:ENSMPUG00000011143 transcript:ENSMPUT00000011237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFKQPSNSNFSLCISGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNH
DRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVA
LIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEI
RVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLD
LEGQKLLQRIQSSDSFPKKNSGSGNADLQSLLPKVSAMLDRLHSTRQHLHQMWHVRKLKL
DQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYV
NINRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEK
YMSNVDSWCKACGEVDLPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPL
TPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQ
QVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQ
TGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHSHVKELWTWLEELQKELLD
DVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSISH
IETVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDF
DTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMAT
RVQDLLEFLHEKQQELDVAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLIT
ASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHW
QQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHV
TPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNEL
FQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQ
ELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME
KYRTSLEKALGISSDSNKSSKSLQLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFI
MAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPAGIVNRELVIFGNMQEIYEFHNNIFL
KELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLAN
SISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGF
DENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSK
LFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIH
LKGALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSG
GCELTVVIHDFTACNSTELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSL
CIAHSRSSMEMEGIFNHKDSLSVSSNDASPPASVASLQPHMMGAQSSPGPKRPGNTLRKW
LTSPVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETVEERGRN
EGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLV
RPTSSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPI
DEMEERKSSSLKRRHYVLQELVETERDYVRDLGCVVEGYMALMKEDGVPDDMKGKDKIVF
GNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYI
DTFFEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMC
IVPKRCNDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDSGLLPRCKERRVFLFEQIVI
FSEPLDKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFALTSRTGGVVETFILHSSSP
SVRQTWIHEINQILENQRNFLNALTSPIEYQRNHSGSGGGGGGGSSGGSSGGGAPGAGGG
NPSTGPGSCSGLPSSSRSRPSRIPQPVRHHSPVLVSSAASSQAEADKMSGMSTPSPAPPL
PGSSPAPEAGPGQPGRHTPGEPEGPQQDSEHIPKMKVIESPRKSSGSAAGAGRDADAKEA
RANQEDSRSRSSLGSLPLGKPRPGAVSPLNSPVATAFPSPIGKEPFPPSSPLQKGGSFWS
SIPASPASRPGSFTFPGDSDSLQRQAQRHTAPGKDTDRMSTCSSASEQSVQSTQSNGSES
SSSSNISTMLVTHDYTAVKEDEISVCQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIP
GFVLGHTSAVIMENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLS
NKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLN
NDGHYSISYSDLGEATLKIIGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGSDGIMVT
WKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQNL
QHPLLIGLLDTFETPTSYVLVLEMADQGRLLDCVVRWGNLTEGKIRAYLGEVLEAVRYLH
NCRIAHLDLKPENILVDQSLAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGN
PISLTSDTWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLDFSFPEDCFKGVSQKAKEFV
CFLLQEDPAKRPSAALALQEQWLQAGHGGGKGVGVLDTSRLTSFIERRKHQNDVRPIRSV
KNFLQSRLLPRV
Download sequence
Identical sequences M3YI95
ENSMPUP00000011052 XP_012916220.1.14098 ENSMPUP00000011052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]