SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011079 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011079
Domain Number 1 Region: 2-355,385-405
Classification Level Classification E-value
Superfamily Thiolase-like 2.43e-73
Family Thiolase-related 0.0019
Further Details:      
 
Domain Number 2 Region: 495-620,683-781
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.8e-41
Family FabD-like 0.0035
Further Details:      
 
Domain Number 3 Region: 1645-1803
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.01e-40
Family Alcohol dehydrogenase-like, C-terminal domain 0.00011
Further Details:      
 
Domain Number 4 Region: 1888-2107
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.87e-32
Family Tyrosine-dependent oxidoreductases 0.00023
Further Details:      
 
Domain Number 5 Region: 1245-1408
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.44e-17
Family Plant O-methyltransferase, C-terminal domain 0.056
Further Details:      
 
Domain Number 6 Region: 1563-1679
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000276
Family Alcohol dehydrogenase-like, N-terminal domain 0.006
Further Details:      
 
Domain Number 7 Region: 2130-2194
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000366
Family Acyl-carrier protein (ACP) 0.00014
Further Details:      
 
Domain Number 8 Region: 620-676
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000301
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0078
Further Details:      
 
Domain Number 9 Region: 2231-2282
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000798
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011079   Gene: ENSMPUG00000011170   Transcript: ENSMPUT00000011264
Sequence length 2309
Comment pep:novel scaffold:MusPutFur1.0:GL896922.1:856725:1068806:1 gene:ENSMPUG00000011170 transcript:ENSMPUT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESDNLQEFWTNLIGGIDMVTDDDRRWKAGLYGLPRRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEATYEAILDGGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLMALQNAYQAIHSGQC
PSAIVGGINILLKPNTSVQFMKLGMLSPEGVCRSFDESGSGYCRAEAVVVMLLTKKSLAR
RVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYEPAGLAPESLEYIEAHGTGTKVG
DPQELNGIDRALCTTRRDPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFC
SPNPEIPALREGRLQVVDRPLPVRGGIVAINSFGFGGSNVHVVLRPNSRPPSPSTPHVTL
PRLLRASGRTAEAVRCLLEQGHRHHRDPAFVSMLNDIAGSPPAAMPFRGFTMLGVQDGGL
EVQEVPQLPPGPRPVWFICSGMGTQWHGMGSSLMRLHGFRESILRSDEVVKPLGLQVSEL
LLSKDETTFDDLVHAFVSLTAIQIALIDLLTSMGVRPDGIIGHSLGEVACGYADGCLTRE
ETILTAYWRGQCIKEASIPPGAMAAVGLSWEECKQRCPPGIVPACHNSEDTVTISGPQAE
MVAFLEQLKEEGVFAKEVRTGGMAFHSYFMEAIAPTLLQALKKVIREPRPRSARWLSTSI
PEAQWQGSLARTSSAEYSVNNLVSPVLFQEALYHVPEHAVVLEIAPHALLQAVLKRGLKS
SCTIVPLMKKDQTDNLEFFLRSVGRLHLLGIDANPNGLYPPMEVPVPRGTPLISPHIKWD
HSQTWDVPAAGDFPSGSSGSSAATVYSIDTSPESPDHYLVDHCIDGRVLFPATGYLCLVW
KTLARSLSQNMDDLPVVFEGVTLHQATILPKTGTVALEVRLLEASRTFEVSENGNLIVSG
KVYQWEDPDPKLFDSQDGPDPTDPTAAFCLSQGDVYKELRLCGYDYGPHFQGVLEANLEG
NAGQLLWKDNWVTFLDAMLQLSILGAAQRSLRLPTRIISLHIDPATHRRKVYSLKGQAQV
ADVVVSSCLNSTVAGGAHISGLHASVAPRRQQEQLAPVLEKFCFTPHVEGGLLAGDTALQ
EELQLCRGLAQALQTKVAQQGLKMVVPGLDGAQVPREPPQQGLPQLLAAACQLQLNGSLQ
MELSQLLAQQRPLLHNDPLLCGLLDAPALKACVDTSLENLTSLRMRVVEVLAGDGCLYSR
VPLLLSTQPMLQLDYTATDRHPQALEAAQAKLQEYNLTQEQWDPAGPVPSSLGPADLLVC
NCAVATLHDPATALSNMAAALKEGGFLLLHTLLRGHPLGETVAFLTCPEPQRGQQSLLSQ
DEWEGLFAQASLRLVALKRSFYGSALFLCRRPAPQGSPIFLPVEDTSFRWVDSLKSVLAD
NTSRPVWLTAVSCPTSGVVGMVNCLRREPGGQRVRCILVSNLSSTSPTPKMDPGSAELQK
VLQGDLVMNVYRDGAWGAFRHFPLEHGLPEEQTEHAFVNVLTRGDLSSIRWVCSPLRHTQ
PTDPRVHLCTVNYASLNFRDIMLATGKLSPDAIPGKWSSRDCMLGMEFSGRDASGKRVMG
LVPAEGLATSVLLSEDFLWDVPSSWTLEEAASVPVVYTTAYYSLIVRGRMQRGETVLIHS
GSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLSETSFANSRDTSFEQHVLRH
TAGKGVDLVLNSLAEEKLQASVRCLAVHGRFLEIGKFDLSNNHQLGMAVFLKNVTFHGIL
LDSLLDDGSSGWREVATLLRAGIRDGVVRPLKCTTFPKHRVEDAFRFMAQGKHIGKVVVQ
VLKEEPEAGPQVPRPTLMTAVSKTFCPAHKSYIITGGLGGFGLELAHWLVLRGAQKLVLT
SRSGIRTGYQAKQVREWRRQGVQVLVSTSNASSLDGARSLIAEATQLGPVGGVFNLAVVL
RDAVLENQTPEFFQDVNKPKYSGTVNLDRVTRAACPELDYFVAFSSVSCGRGNAGQTNYG
FANSTMERVCERRRHDGLPGLAVQWGAIGDVGLILESMGSNDMVIGGTLPQRMSSCLGVL
DFFLSQPYPVLSSFVLAEKKAATQGDSSAQQDLMKAVAHILGIRDLATINLDSTLADLGL
DSLMGVEVRQMLEREHDLLLSMRDIRQLSLRKLQELSSKGGPAKELENAMPKNSSLAHQQ
AQPNLSTLLVNPEGPTLTRLNSVQSSERPLFLVHPIEGSVTVFHSLAARLSIPTYGLQCT
RAAHQPLEVLQPQSRPAGEDPAIGLHLFS
Download sequence
Identical sequences M3YIC2
ENSMPUP00000011079 ENSMPUP00000011079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]