SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011093 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011093
Domain Number 1 Region: 280-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011093   Gene: ENSMPUG00000011185   Transcript: ENSMPUT00000011279
Sequence length 334
Comment pep:known scaffold:MusPutFur1.0:GL897070.1:3816489:3820857:1 gene:ENSMPUG00000011185 transcript:ENSMPUT00000011279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPSHATTWGRALWAVLLTTLGSVASQPLGGESVCTARPLAKYSITFTGKWSQTAFPKQ
YPLFRPPAQWSSLLGAAHSSDYSLWRKNQYVSDGLRDFAERGEAWALMREMEAAGEKLQS
VHEVFSAPAVPSGTGQTSAELEAHSRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQ
VAVDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKSLPPIARV
TLVRLRHNPRAFVPPAPGPVGAGGSNEIVDSVSVAETPLDCEVSLWSSWGLCAGPCGKLG
AKSRTRYIRMQPANHGAPCPELEEEAECVPDNCV
Download sequence
Identical sequences M3YID6
XP_004772379.1.14098 ENSMPUP00000011093 ENSMPUP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]