SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011101 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011101
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.43e-23
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 54-88
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000131
Family Intermediate filament protein, coiled coil region 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011101
Domain Number - Region: 57-205
Classification Level Classification E-value
Superfamily Tropomyosin 0.00379
Family Tropomyosin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011101   Gene: ENSMPUG00000011193   Transcript: ENSMPUT00000011288
Sequence length 407
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4443539:4449539:1 gene:ENSMPUG00000011193 transcript:ENSMPUT00000011288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYNCCLPNVSCRSTCSSRPCVPPSCHTCTLPGACNIPANVGNCGWFCEGSFNGSEKETM
QFLKDRLASYLEKVRQLERENAELERRIREWCQQQVPFVCPSYQSYFRTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTMYETELGLRQLVESDINALRRILDELTLCKSDLEAQV
ESLKEELLSLKQNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRSQYEALVETNR
RDVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TETEARYSSQLSQLQCMITNVESQLAEIRSDLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATTNACDRPIGPCVTNPCTPCGPRSRCGPCNTFGC
Download sequence
Identical sequences M3YIE4
ENSMPUP00000011101 ENSMPUP00000011101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]