SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011170 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011170
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.17e-23
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 54-88
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000628
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011170
Domain Number - Region: 57-205
Classification Level Classification E-value
Superfamily Tropomyosin 0.0327
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 167-282
Classification Level Classification E-value
Superfamily Prefoldin 0.068
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011170   Gene: ENSMPUG00000011262   Transcript: ENSMPUT00000011358
Sequence length 404
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4462855:4467328:1 gene:ENSMPUG00000011262 transcript:ENSMPUT00000011358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYNCCLPNVSCRSTCSSRPCVPPSCHTCTLPGACNIPANVGNCGWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERENAELESRIREWCQQQVPFVCPSYQSYFRTIEELQQKILCS
KAENARLVVQIDNAKLASDDFRTKYETEVGLRQLVESDINGLRRILDELTLCKSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRSQYEALVETNR
RDVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TETEARYSSQLSQLQCMITNVESQLAEIRCDLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVSNPCTQRARCGPCNTFVR
Download sequence
Identical sequences M3YIL3
ENSMPUP00000011170 ENSMPUP00000011170 XP_004772813.1.14098 XP_012901344.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]