SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011311 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000011311
Domain Number - Region: 72-124
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00769
Family Chromo barrel domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011311   Gene: ENSMPUG00000011403   Transcript: ENSMPUT00000011499
Sequence length 270
Comment pep:novel scaffold:MusPutFur1.0:GL896948.1:4345076:4346105:1 gene:ENSMPUG00000011403 transcript:ENSMPUT00000011499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPESRVLKLMDNNLQKTTSNNLLEDCWSTAEEPGTGSPRQLGEPPILGSLRKTRKNKQKT
PGNGDGGSASKAPQPPQKKERKKERKGTKEGKKERKKENRMEVKVKIPEELKSWFVQDWD
LVTRKQLFQLPAKENADAILEEYANCKKLQGNVGNKEYVVNEVVARIKEYFNVMLGIQLL
HKFGRPHYEEILLACPDMPMSQVQGALHLQRLFVKIGAMLAYRPLDEKTLALLLGYSHDF
LKYLPRNATSLFTASDYKVASPPQSPVRVY
Download sequence
Identical sequences M3YJ04
ENSMPUP00000011311 ENSMPUP00000011311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]