SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011331 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011331
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-21
Family Pyrin domain, PYD 0.0000445
Further Details:      
 
Domain Number 2 Region: 109-191
Classification Level Classification E-value
Superfamily DEATH domain 2.03e-16
Family Caspase recruitment domain, CARD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011331   Gene: ENSMPUG00000011423   Transcript: ENSMPUT00000011519
Sequence length 193
Comment pep:known scaffold:MusPutFur1.0:GL897085.1:306028:308851:1 gene:ENSMPUG00000011423 transcript:ENSMPUT00000011519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTRDAILDALENLTADEFKKFKLKLLSVPLREGYGRIPRGTLMSMDAIDLTDKLVSSY
LEEYSTELTVIVLREMGMQETAEHLQIKCTGPAPGPAGIQDHQTGTSPAPHFVDRHRAAL
ITRVTDVEGVLDALYGTVLSGGQYEAVRAEPTNTMKMRKLLTFAPAWDKTCKDLLLQALR
NTHPYLVADLEKS
Download sequence
Identical sequences M3YJ24
ENSMPUP00000011331 ENSMPUP00000011331 XP_004773870.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]