SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011336 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011336
Domain Number 1 Region: 369-579
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 561-693
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 822-918
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-22
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 4 Region: 673-787
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.73e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011336   Gene: ENSMPUG00000011428   Transcript: ENSMPUT00000011524
Sequence length 960
Comment pep:novel scaffold:MusPutFur1.0:GL897260.1:145312:184611:1 gene:ENSMPUG00000011428 transcript:ENSMPUT00000011524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHRAQGGAGPSETEHPTTNAPGAAPPVSVDTDPGASEPGLPVLRGSVSALGGPLDPQC
AGPSDASLGAAPGPRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQRLRSDPGPPTESPNQRPSPLKRTPGPKPQVPPKPSYLQMPRMPPQPEPI
PPPPSRPLPADPRVAKGLAPRVEASPSSAAVSSLIEKFEREPVIVASDRPAPGPSPGPIE
PAVLPQPPPQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPPSHSLCPGTPALASVPVALADSHRPGSQEVDSDLEEEDDEEEDEKDREIPVLPME
RQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHGI
FSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELV
NTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDS
KDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLS
AKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVS
GKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDLG
KRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNRV
CTDCYVALHGVPGSSPVCSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHKA
WFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYF
SPETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAASGAIAEPSEAPQTQDKT
Download sequence
Identical sequences M3YJ29
ENSMPUP00000011336 ENSMPUP00000011336 XP_004780636.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]