SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011358 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011358
Domain Number 1 Region: 903-1251
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.49e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000904
Further Details:      
 
Domain Number 2 Region: 724-898
Classification Level Classification E-value
Superfamily ARM repeat 2.4e-45
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0006
Further Details:      
 
Domain Number 3 Region: 571-706
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-20
Family PLC-like (P variant) 0.026
Further Details:      
 
Domain Number 4 Region: 1273-1387
Classification Level Classification E-value
Superfamily PX domain 7.46e-19
Family PX domain 0.0041
Further Details:      
 
Domain Number 5 Region: 1415-1520
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000207
Family Synaptotagmin-like (S variant) 0.01
Further Details:      
 
Domain Number 6 Region: 270-390
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000501
Family Ras-binding domain, RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011358   Gene: ENSMPUG00000011448   Transcript: ENSMPUT00000011546
Sequence length 1523
Comment pep:known scaffold:MusPutFur1.0:GL896948.1:5726985:6081914:-1 gene:ENSMPUG00000011448 transcript:ENSMPUT00000011546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHFRKIYASGKFLSSFIISSGRHLSRINTLNYIKKTMAYYWKTDLNTSESHQEQREHQE
FHSVNQFLFPSQVSLGFDQLVSEISNKIPLCQTEMEENTVFVPSAPSGNSRKYSLDETHQ
IPSNEFTSKSSEHSCHQVRKIPVIGFRSSVLPKPENMNKGTSSGNPIGKYHGADDYRFNI
LASSSTSLDKINSQRESENENHNYHIGFESSIPSMYPSFSPDFMPKEDNKRCRNMDIVER
SLMPFEGSSLPRTWENTWPKNRKLTGYSLQLVEVPQGSNKTLASFCDKVKKIRETYHAAD
INSNSGKIWSTTTAFPYQLFSNTKFNISICIDNSTQVLHFMPYANYLVKDLIAEILHFCT
NDQLFPKDHLLSICGYEEFLQNDYSLGSHRIFQKDKSVIQLNLQKNGEVPGKLSRKHEDD
HSQFYLNQLLEFMHIWKVSRQCLSTVIKKYDFHLKCLLKTQQNVDDIIEEVKNICSVLGC
VETKQITDAVNELNLILQRETENFHENSETSAKGLIEKVTNELSRSIYQLINAYCYSFYA
DFQPLKVPDEISYVNPGLHSHLSFTVYAVHNIPEIWVHSYKAFSFSCWLTYAGKKLCQVR
SYRNIPVKKLFFLLVNWNETINFPLEIKSLPRESMLTIRLFGIVCATSNANLLAWTCLPL
FPKDKSILGSMLFSMTLENEPPIEMIAPGLWDISLPSPLILQIDFPATEWEYMKLDSEEN
RNDLEEPPKECLKHIARLSQKQSPLLLSEEKRRYLWFYRFYCNNENCSLPLVLGSAPGWD
ERTVSEMHTILRRWKFSCPLEALGLLTASFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQ
AVKFEWNLESPLVQLLLHRSLQSIQIAHRLYWLLKDAQNETYFKSWYQKLLAALQFCSGK
ALSDELSKEKKLIKILGDIGEKVKSASDPQRQEVLKKEIGRLEEFFQCIKTCHLPLNPAL
CVKGVDRDACSYFTSHALPLKITFINANPMGKNISVIFKAGDDLRQDMLVLQIIQVIDNI
WLQEGLDMQMIIYRCLSTGKGQGLVQMVPDAITLAKIHRHSGLIGPLKENTIKKWFSQHN
HLKEDYEKALRNFFYSCAGWCVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTF
GGIKRDRAPFIFTSEMEYFITEGGKNPQHFQDFVELCCQAYNIVRRHSQLLLNLLEMMLH
AGLPELSGIQDLKYVYNNLRPQDTELEATSHFTKKIKESLECFPVKLNNLIHTLAQMTAI
NPAKSTSPTLPQESCMLNVTRSIQRATILGFSKKTSNLYLIRVTHSNNETSLTEKSFDQF
SKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHKRFRDLNHYMEQILNGSYEVANSDCVLS
FFLSEPVQQTIEESSLVDLGEKFPDKTPKVQLVISHEDTKLTILVKHMKNIHLPDGSAPS
AHVEFYLLPYPSEVRRRKTKSVPKCTDPTYNEIVVYDEVTELRGHVLMLIVKSKTVFVGA
INIQLYSVPLNEEKWYPLGNCII
Download sequence
Identical sequences M3YJ51
ENSMPUP00000011358 ENSMPUP00000011358 XP_004755800.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]