SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011415 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011415
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.17e-21
Family PB1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011415   Gene: ENSMPUG00000011505   Transcript: ENSMPUT00000011603
Sequence length 401
Comment pep:known scaffold:MusPutFur1.0:GL897065.1:2218854:2247809:1 gene:ENSMPUG00000011505 transcript:ENSMPUT00000011603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTSIPENDTVDGRDEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQN
EGPMYQQYPQQAGYGAQPPQAPPQPPQQYGIQYSAGYSQQTGPQQPQQFQGYGQQPASQA
PAPAFAGQPQQLPAQPAQQYQASSYPSQTYTTQTSQPTNYTVAPASQPGMAPSQPGAYQP
RPGFTPPPGSTMTPPPSGPNPYARTRPPFGQGYTQPGPGYR
Download sequence
Identical sequences M3YJA8
ENSMPUP00000011415 XP_004772020.1.14098 ENSMPUP00000011415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]