SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011444 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011444
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-19
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011444
Domain Number - Region: 342-413
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00575
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011444   Gene: ENSMPUG00000011535   Transcript: ENSMPUT00000011633
Sequence length 478
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:560719:566633:1 gene:ENSMPUG00000011535 transcript:ENSMPUT00000011633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYENEDQCWGALESFRVKLISIIDPSRITPYLRQCKVLSPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLM
SEVLKLQRRVQELTQRLGSRDELAAELRLKDGLLRKHQERVQRLREECEAGARELRRCKE
ENYDLALRLARQSEEKGAALTHSRDLQLEVERLKHCLMKAEDDCRVERRNTLKLRHAVEQ
RPSQELVWELQQEKTLLRARVQELEATVQEGKPDKSSPYVQVLEGDWRQALRDHQEQADT
ILSLRKALRQGEALHARCVEEKEMFELQCLALRKDSEMYKDRIEAVLRQMEEVAGERDQA
IATREELHAQHSRSLREKDALRKQVRELAEKADDLQLQLFQREGQLLAAEGRLRRQQLDA
LVLSSDLEDSSPRNSQELSLPLDLEAIQLSDKGGPADGDSPQQPFAALQEEHLSLTPN
Download sequence
Identical sequences M3YJD7
ENSMPUP00000011444 ENSMPUP00000011444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]