SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011499 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011499
Domain Number 1 Region: 178-322
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 2 Region: 829-981
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-34
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 468-703
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-33
Family DBL homology domain (DH-domain) 0.00085
Further Details:      
 
Domain Number 4 Region: 78-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 689-811
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 1-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-22
Family First domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011499   Gene: ENSMPUG00000011591   Transcript: ENSMPUT00000011689
Sequence length 998
Comment pep:novel scaffold:MusPutFur1.0:GL896915.1:12380657:12620545:-1 gene:ENSMPUG00000011591 transcript:ENSMPUT00000011689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQI
RRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQ
SEIGDFDEASDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMY
GIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDAN
SSYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQK
QVLDYVKEGGHKKVQFERKHSKIQSIRSLATQPTEPNSEVPKQAQPSAGLPPREGAEPAG
GPQGEEPSAPAEEPRRSPALPRSPAGGGKADGAARAAADEEEEVVKDRTQQSKAQPPQPS
TGSLTGSPHLSELSINSQGGAVPASVILSPNLSPDTKQASPLVSPLLNDQACPRTDDEEE
GRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSAVSKEDAMPEALKSLIFSNFEP
LHKFHTSFLKETEQRLALWEGRSNAHIRGDYQRIGDVLLKNIQGMKQLAVHLWKHSEALE
ALETGIRGSRRLENLCRDFELQKVCYLPLNTFLLRPLHRLVHYKRLLIGERITRMWPPLT
GPASGHRAALAEITELVVQLHGTMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLS
KLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTL
RGQRQSVVVAASSRSEMEKWVEDIQMAIDLAEKSSGPTPEFLASSPPDNKSPDEATVADQ
ESEDDLSASRTSLERQAPPRGNTTVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSN
GWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESEDIHKDYVFKLHFKSHVY
YFRAESEYTFERWMEVIRSATSSTSRAHVLSHRESHGY
Download sequence
Identical sequences M3YJJ2
ENSMPUP00000011499 ENSMPUP00000011499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]