SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011590 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011590
Domain Number 1 Region: 228-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-49
Family Reprolysin-like 0.0072
Further Details:      
 
Domain Number 2 Region: 993-1049
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000798
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 541-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 886-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 821-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 945-988
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000732
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011590   Gene: ENSMPUG00000011684   Transcript: ENSMPUT00000011782
Sequence length 1113
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:2056593:2316574:-1 gene:ENSMPUG00000011684 transcript:ENSMPUT00000011782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTHICCCCLLYQLGVLSNGIIAGLQFAPDREEWEVVFPALWRREPVDAAGGSGGSAPP
AQEAEPDGDEVLLRIPAFSRDLYLLLRRDGRFLAPRFEVEQRPSPGPGPTRAAAAPRPPA
PPDASCFYTGAVLRHPGSLASFSTCGGGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYR
QKRSVEEKVTEKSAPHSHYCGIVSDKGRPRSKKITESGRGKRYSYKLPQEYNIETVVVAD
PAMVSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVIKLILLHETPADLYIGHHGE
KMLESFCKWQHEEFGKKNDIHLEMSTSWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIA
YLSGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQ
NLGDVSWSRCSKEDLERFLRSKASNCLLQTNPQSVNSVMVPSKLPGMTYTADEQCQILFG
PLASFCQEMQHVICTGLWCKVEGEKECRTKLDPPMDGTDCDTGKWCKAGECTSRTLAPGH
VAGEWSEWSPCSRTCGSGISSRERECPGLGSEARDCNGPRKQYRICENPPCPAGLPGFRD
WQCQAYSVRTSYPKHVLQWQAVMDEEKPCALFCSPIGKEQPVLLSEKVMDGTSCGYQGLD
VCANGRCQKVGCDGLLGSLAREDHCGVCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGA
RRIKVVEEKPAHSYLALRDAGKQSINSDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGP
TTSPLHLLVLLFQDQNYGLHYEYTIPSDPLPENQSSKAPEPLFMWTHTGWEDCDATCGGG
ERKTMVSCTKIMNKNISIVDSKKCKYLTKPEPQIRKCHEQPCQTRWMMTEWTPCSRTCGK
GTQSRQVACTQQMSNGTLIRARERDCAGPKPASAQRCEGQDCMTVWEAGVWSECSVKCGK
GVRHRTVRCTNPRKKCVLSTRPREAEDCEDYSKCYVWRMGDWSKCSVTCGKGMQSRVIQC
MHKITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCR
VIREKNLCQDMRWYQRCCETCRDFYAQKLQQKS
Download sequence
Identical sequences M3YJT3
ENSMPUP00000011590 ENSMPUP00000011590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]